(data stored in ACNUC7421 zone)

EMBL: CP001622.PE529

CP001622.PE529       Location/Qualifiers
FT   CDS_pept        559252..560106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0536"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: dsh:Dshi_3150
FT                   aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54841"
FT                   /db_xref="GOA:C6B2M1"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M1"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ACS54841.1"
FT                   /translation="MRQVYVNGDYLPETEARISVFDRGFLFADGVYEVTLVLDRKLVDF
FT                   AGHMRRLRHSLGELDMAFALTNEKLLDIHRELIRRNDIEEGLVYLQVTRGAADRDFLFP
FT                   ADATPRTVVVFTQKKSLVDSPLAERGLHVITVEDLRWRRCDIKTVQLLYPSMAKMEAKS
FT                   RGADDAWMVRDGFVTEGSSNNAYMVTLEGTVVTRDLSTDILRGITREAVLQCAQDLQLR
FT                   IEERPFTVEEVENAAEAFSTSSSGLVSPVVRINERVVGKGTPGPMAARLRQLYLERSRA
FT                   SAI"
     atgcgccaag tctatgttaa tggggactat ctgcctgaaa ccgaggcccg gatttctgtc        60
     tttgatcggg gctttctgtt tgccgacggg gtctatgagg taacgctcgt actcgaccgt       120
     aagcttgttg attttgcggg ccatatgcgc cgcctgcgcc actcgctcgg cgaactcgac       180
     atggctttcg cactgaccaa cgagaaactg ctggatatcc atcgggaact gatccggcgg       240
     aacgatatcg aggaagggct ggtctatctg caagtgaccc ggggggccgc cgatcgcgac       300
     tttctctttc ccgccgatgc gacgcccaga acggtcgtgg ttttcacgca gaaaaaatcg       360
     ctcgttgata gcccattggc ggagcgcggg ctccatgtca tcacggtgga agatttgcgg       420
     tggcgacgtt gcgatatcaa gacggtgcaa ctcctctacc cctccatggc aaagatggaa       480
     gccaagtcgc gcggcgccga cgacgcgtgg atggtcagag atggctttgt gaccgaaggc       540
     tcatcgaaca atgcctatat ggtgaccctg gagggcacgg ttgtgacaag ggatctctca       600
     accgatatcc tgcgcgggat cacgcgtgag gctgttttgc aatgcgcaca ggatcttcag       660
     ctgagaatcg aggagcgtcc gtttaccgtc gaggaggtcg agaacgccgc cgaggcgttt       720
     tcgacctcct catccggcct ggtcagtcca gtcgtcagga tcaacgagcg ggtggtcgga       780
     aagggaacgc cgggaccaat ggcagcccga cttcggcagc tctaccttga gcgaagccga       840
     gcctcggcta tctag                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page