(data stored in ACNUC7421 zone)

EMBL: CP001622.PE53

CP001622.PE53        Location/Qualifiers
FT   CDS_pept        complement(55019..56116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0054"
FT                   /product="putative SAM-dependent methyltransferase protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000436 probable SAM-dependent
FT                   methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54365"
FT                   /db_xref="GOA:C6AYE1"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE1"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000436"
FT                   /protein_id="ACS54365.1"
FT                   /translation="MKQREGRPGQKKTSGPSGENRRDDRAGRPPKPVAQPAATREAVRE
FT                   AAVPAAVVRPLMTRSGERPTERVPVILESLGAGDFHLIDSGNGEKLEQYGPYRIIRPEA
FT                   QALWRPSLAPQVWEKVDAAFTGDTDEEGAGRWRFPKEALGETWPLNLLGVDFLGRFTSF
FT                   RHVGVFPEQIVHWSWMKEQVEKAGRPLKVLNLFGYTGVASLVAAAAGAEVTHVDASKKA
FT                   IGWARENQALGRMEKLPIRWICEDAMKFILREERRGSQYDIILTDPPKFGRGPNGEVWH
FT                   LFEHLPLMLDVCREILSPKAVGLVLTAYSIRASFYSIHELMRETMRGAGGVVESGELVI
FT                   REAGTDGKTQGRALSTSLFSRWVPK"
     ttgaaacaga gagaaggccg gccgggccag aagaaaacat caggtccttc cggtgaaaat        60
     cgcagggacg atcgggcagg ccggccgccg aagccggtcg cgcagcccgc ggcaacccgc       120
     gaggcggtgc gcgaggctgc tgtgcctgcc gccgtcgtgc gtcctctgat gacacgcagc       180
     ggcgagcggc cgactgagcg cgtgcccgtc attctcgaat cgctcggggc cggcgacttc       240
     cacctgatcg acagcggcaa cggcgaaaag ctcgagcaat acggccccta tcgcatcatc       300
     cgtccggaag cccaggcgct gtggcggcct tcgctggcgc cccaagtctg ggaaaaggtc       360
     gatgccgcct tcaccggcga taccgacgag gaaggcgccg gccgctggcg ctttccgaag       420
     gaggcgctcg gcgagacctg gccgctcaat ctgctcggtg tcgattttct cggccgcttc       480
     acctccttcc gtcatgtcgg cgtcttcccg gagcagatcg tccactggag ctggatgaaa       540
     gagcaggtcg aaaaggccgg ccggccgctg aaggtgctga acctcttcgg ttataccggc       600
     gtcgcctcgc tggttgccgc cgcagctggc gccgaggtca cccatgtcga cgcctcgaag       660
     aaggcgatcg gctgggcaag ggaaaaccag gcgctcgggc gcatggagaa gttgccgatc       720
     cgctggatct gcgaggatgc gatgaaattc atcctgcgcg aggaacgccg cggcagccaa       780
     tacgatatca tcctcaccga tccgccgaaa ttcggccgcg gccccaatgg cgaagtctgg       840
     catctcttcg agcatctgcc tctgatgctc gacgtctgcc gcgagatcct gtcgccgaag       900
     gccgtgggcc tggtgctgac ggcctattcg atccgcgcca gcttctattc gatccatgag       960
     ctgatgcgcg agacgatgcg tggcgccggc ggcgtggtcg aatccggcga gttggtgatc      1020
     cgcgaggccg gcaccgacgg caagacgcag ggccgcgcgc tctccacctc cctcttttcc      1080
     cgctgggtgc cgaaatga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page