(data stored in ACNUC7421 zone)

EMBL: CP001622.PE531

CP001622.PE531       Location/Qualifiers
FT   CDS_pept        complement(560667..562469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0539"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   MutL dimerisation; DNA mismatch repair protein domain
FT                   protein; ATP-binding region ATPase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000937 DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54843"
FT                   /db_xref="GOA:C6B2M3"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M3"
FT                   /inference="protein motif:TFAM:TIGR00585"
FT                   /protein_id="ACS54843.1"
FT                   /translation="MAIRQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEIA
FT                   TSGGGKALLRVSDNGSGMDAADLELAVRRHCTSKISETLEDIRTLGFRGEALPSIGSVA
FT                   RLSIASRRRDSTGGHEIAVAGGKIAHMRPAAANPGTIVEVRDLFFATPARLKFLKTEKA
FT                   EAGAITEIVKRMAIAFPAVRFVLSGSDRTTLEFPATGDDHLARMAQVLGKEFRDNAIAL
FT                   DAVREEIALTGFAGVPTFNRGNSAHQYAFVNGRPVQDKLILSAIRGAYAETIPSGRYPV
FT                   AVLAITLDPALVDVNVHPAKSDVRFRDPSLVRGLIVGAIREALARDGSRAATTGASDML
FT                   RSFRPGFQPNNQRPQTAWSAETSPSQPYQPATGFGERPQASFDGLSMPTARAEPQFSPQ
FT                   PAVAEPNTRYPLGAARAQIHANYIVAQTEDGLVIVDQHAAHERLVFEAMRKALHSKRLA
FT                   SQVLLIPEIVDIPEEDCDRLMQHAAELSELGLAIERFGPGAIAVRETPAMLGEVDAHGL
FT                   IRQLADEIAEWDTASGLSAKLEYVAATMACHGSVRSGRRLRPEEMNALLREMEVTPGSG
FT                   QCNHGRPTYIELKLSDIERLFGRS"
     atggccatca gacagctttc cgaaacgctc atcaaccaga tcgccgccgg cgaagtcatc        60
     gaacggccgg cgagcgctgc caaggaactg atcgaaaacg cgctcgacgc gggtgcgacg       120
     cgcatcgaga tcgccacatc aggcggcggc aaggcgctgc tgcgcgtcag cgacaacggc       180
     tcgggcatgg acgcggccga tctggaactg gcggtcaggc gccactgcac ctcgaagatc       240
     tcagagacgc ttgaggatat ccgcacgctc ggcttccgcg gcgaggcgct gccctcgatc       300
     ggctcggtcg caaggctcag cattgcaagc cgcaggcgcg acagcacagg cggccacgag       360
     attgccgttg ccggcggcaa gatcgcgcat atgcgcccgg ctgccgccaa tcccgggacg       420
     atcgtcgaag tgcgcgacct gttcttcgcg acacccgccc ggctcaaatt cctgaagacg       480
     gagaaagccg aggccggcgc cattaccgag atcgtcaagc gcatggcgat cgcctttccg       540
     gcggtacgct tcgtgctgtc gggttcggac cgcacgacac tggaatttcc ggcgaccggc       600
     gacgaccatc tggcgcgcat ggcgcaggtg ctcggcaagg agttccgcga caacgccatt       660
     gcgctcgacg cggtgcgcga ggagatcgcg cttaccggct ttgccggcgt gccgaccttc       720
     aatcgcggca actccgccca ccaatacgct ttcgtcaacg gccggccggt gcaggacaag       780
     ctgatcctct cggcgatccg cggcgcctat gccgagacga tcccatccgg acgctatccg       840
     gtggcggtgc tggcgatcac gctcgatccc gctctggtcg acgtcaacgt gcatccggca       900
     aaatccgacg tgcggttccg cgatcctagc ctggtgcgcg gcctgatcgt cggcgccatc       960
     cgcgaggccc tggcgcgcga cggcagccgg gcggcaacca ccggcgcgag cgacatgctg      1020
     cgctccttcc gccccggttt ccagccgaat aaccagcggc cgcaaacggc atggtcggcc      1080
     gaaacctcgc cctcccagcc ctatcagccg gcaacgggat tcggcgagcg gccacaggcg      1140
     tccttcgacg gactttcgat gccgacggcg cgggccgagc cgcagttttc gccgcagccg      1200
     gcagtcgccg aaccaaacac gcggtatccg ctcggcgcgg cgcgggcgca gatccacgca      1260
     aactacatcg tcgcccagac cgaggatggg ctcgtcatcg tcgaccagca tgccgcgcat      1320
     gagcggctgg ttttcgaggc gatgcgcaag gcgctgcatt cgaagcggct ggcctcgcag      1380
     gtgctgctca tccccgagat cgtcgatatt ccggaagagg actgcgaccg gctgatgcag      1440
     catgcggccg agctttccga actcggcctg gcgatcgagc gtttcggccc aggcgcgatc      1500
     gccgtgcgcg agacgccggc gatgctcggc gaggtcgatg cgcatgggct gatccgccag      1560
     cttgccgacg agatcgccga atgggacacg gcgtcgggcc tatcggccaa gctcgaatat      1620
     gtggcagcga ccatggcctg ccacgggtcg gtgcgctcgg gacggcggct gcggccggag      1680
     gaaatgaacg cgctgctgcg ggagatggaa gtgacccccg gctccggcca gtgcaatcac      1740
     ggccggccga cctatatcga attgaagctc agcgatatcg agcggctttt cggcagaagc      1800
     taa                                                                    1803
//

If you have problems or comments...

PBIL Back to PBIL home page