(data stored in ACNUC7421 zone)

EMBL: CP001622.PE532

CP001622.PE532       Location/Qualifiers
FT   CDS_pept        562653..564374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0540"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000938 probable two-component
FT                   sensor histidine kinase protein; TIGRFAM: PAS sensor
FT                   protein; PFAM: response regulator receiver; PAS fold domain
FT                   protein; PAS fold-4 domain protein; SMART: response
FT                   regulator receiver; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54844"
FT                   /db_xref="GOA:C6B2M4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M4"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACS54844.1"
FT                   /translation="MSAGFEKADTSSEIDGAPAEADLQTALFDVVCDSLSAAFIIYDKN
FT                   DHLVFASRQILEFFPLPSEMLKPGTRLRDFLGAMYDTGIRQQYDVRQGGSLSREDWLSQ
FT                   KIASHWRERFDAVERHGADRWVRFVKRRLPGGYGVSIISDISESKKREEQWRSDLERVQ
FT                   LTEDILDNLPFPLFVKDRNLTYVAVNLAFCEKYQTSADEVLGRKSGDLFSEEIAKRFEE
FT                   SDRHVLETGEMSVSRQRQISRDGIERDIVSRKHRIGKPGRYFLVSTMQDLPRDGADLDE
FT                   FGQASAITASSNQSYRRAYVPVPSGIERREPAAMEAIVPENFSGRKVLVVTADLAAETA
FT                   ALRTLTKYGFESCSVRGEDEEERFLEIATSSGISLDLLIIDNQMGMRCLELAEQYGIPA
FT                   LVMDGFQIANELTFQIARHFNRNSRNAAGSDADWEISTSDDAIGLQVLVAEDNDINQIV
FT                   FSQILEGLGYRHMLAATGDEAVRLWAEHRPQIVLMDISLPGFNGFEAARLIRQMEETGG
FT                   SIRTPIIGVLTQAFERDRAECVKSGMDDVIMKPVSPDMLETIFQKYLMNEAMRAQN"
     atgagtgccg gcttcgaaaa ggcggacaca tcatcagaaa tcgatggagc tcccgccgag        60
     gccgatctgc agacggcgct tttcgatgtg gtgtgcgaca gcctttccgc agctttcatc       120
     atctacgaca agaatgatca tctggtcttc gcaagccgcc agatacttga attctttccg       180
     ctgccgtccg aaatgctgaa gcccggcacg cggcttcgcg atttcctcgg cgcgatgtac       240
     gacaccggca ttcgccagca gtatgatgtc aggcagggcg gctcgctgag ccgcgaagac       300
     tggctgtcac agaaaatcgc ctcgcattgg cgcgagcgct tcgatgccgt cgagcgccac       360
     ggcgccgacc gctgggtccg cttcgtcaag cgcaggctgc cgggcggtta cggcgtcagc       420
     atcatctccg acatttccga gagcaagaag cgcgaagagc aatggcgctc cgatctggag       480
     cgggtgcagc tcaccgagga cattctcgac aatctgccgt tcccgctatt cgtcaaggat       540
     cgcaacctca cctatgtcgc ggtgaacctt gccttctgcg agaaatatca gacgagcgcc       600
     gacgaggtgc tcgggcgcaa gagcggtgat cttttttcag aagagatcgc caagcgcttc       660
     gaagaaagcg accgccatgt gctggagacc ggcgagatgt ccgtctcccg ccagcggcag       720
     atctcccgcg acggcatcga gcgcgacatc gtcagccgca agcaccgcat cggcaagccc       780
     ggccgctatt tcctggtgtc gaccatgcag gatctgccgc gcgacggcgc cgatctcgac       840
     gaattcggcc aagcgtccgc gatcaccgcc tccagcaatc aaagctatcg ccgggcctat       900
     gtgccggtgc caagcggcat cgaacggcgc gagccggcgg cgatggaagc gatcgttccg       960
     gagaatttct ccggccgcaa ggtcctcgtc gtcactgccg acctcgccgc cgagaccgcc      1020
     gcgctgcgga cgctgacgaa atacggcttc gaatcctgct cggtccgcgg tgaggacgaa      1080
     gaggagcggt tcctggaaat cgccacctcc tccggcattt cgctcgatct cttgatcatc      1140
     gacaaccaga tgggcatgcg ttgcctcgaa cttgccgaac aatacggtat tccggcgctc      1200
     gtcatggacg gtttccagat cgccaacgag ctcaccttcc agatcgcccg ccatttcaat      1260
     cgcaacagcc gcaacgccgc cggttcggat gcggattggg aaatcagcac ttccgacgac      1320
     gcgattggcc tgcaagttct cgtcgccgaa gacaacgata tcaaccagat cgtcttttcg      1380
     cagatcctcg aaggtctcgg ctatcgccat atgctggcgg cgaccggcga cgaggccgtg      1440
     cgcctctggg ccgagcaccg gccgcagatc gtgctgatgg atatttccct gccgggcttt      1500
     aacggcttcg aggccgcgcg cctcatccgg cagatggagg aaaccggcgg cagcatccgc      1560
     accccgatca tcggcgtgct cacccaggcc ttcgagcgcg accgcgccga atgcgtcaag      1620
     tcaggcatgg acgacgtcat catgaaaccc gtcagccccg acatgctgga gaccatattt      1680
     cagaaatacc taatgaatga ggccatgcgg gcgcaaaact ga                         1722
//

If you have problems or comments...

PBIL Back to PBIL home page