(data stored in ACNUC7421 zone)

EMBL: CP001622.PE533

CP001622.PE533       Location/Qualifiers
FT   CDS_pept        564528..565892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0541"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="KEGG: ret:RHE_CH00850 putative sensory box/GGDEF
FT                   family protein; TIGRFAM: diguanylate cyclase; PFAM: EAL
FT                   domain protein; GGDEF domain containing protein; SMART: EAL
FT                   domain protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54845"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M5"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACS54845.1"
FT                   /translation="MMKSADIAFLTVGQNELQAMAYTDPLTGLGNRNRMRDKVLQISAE
FT                   RASDPAPFTIGIVNLDSFKPINDLFGSTAGDEILCQVAHRLRACIPDGALVTRHDGDEF
FT                   AFVLPLIFERASAEKFGQMIREVLSAPYDLGDRNVRLSASLGFSIYPFAGEDCEELLKS
FT                   AETALYRSKRRGRGQITVYSREIAQEMKRATQLEQALRNAIISDAIDVHFQPIVSLSNN
FT                   QVVGFEALARWNDPDLGFVSPGVFVPLAEERGFIDALSEALLRKAAEAALSWPRELFLS
FT                   FNLSSAQLMDPGTSSSVLSILGRVGFDPHRLELEITETAVMSSADTAHRIIADLRAAGV
FT                   RISLDDFGTGQSSLGRLRDFIFDKIKIDRAFVSRINSDRASEHIIKAILTMCEGLELEV
FT                   VAEGIEDYAEAVKLRTLGCGMGQGYHFGRPADGIATLRFLHENYYDPTMVERVSA"
     atgatgaaat cggcggacat agctttcttg accgtcggtc agaatgagct tcaggcgatg        60
     gcctataccg atccgctgac cggattgggc aatcgcaatc gcatgcggga caaggtcttg       120
     cagatctccg ctgagcgcgc cagcgatccg gcccccttca ccatcggtat cgtcaacctc       180
     gacagtttca agccgatcaa cgatctattc ggctcgacag ccggcgatga aatcctctgc       240
     caggtcgccc atcgtctcag ggcctgtatt ccggatggcg cgctggttac ccgccacgat       300
     ggcgacgaat tcgccttcgt gctgccgttg atcttcgagc gggcgagtgc cgagaaattc       360
     ggccagatga tccgcgaggt gctgtcggcg ccgtatgacc tcggggaccg caatgtccgt       420
     ctctccgcct ccctcggctt ttccatctat cccttcgccg gagaggattg cgaggaactg       480
     ctgaagagcg ccgaaaccgc gctctaccgt tccaagcgcc gcggccgcgg ccagatcacc       540
     gtctattcgc gcgagatcgc ccaggagatg aagcgcgcca cgcagctgga gcaggcgctc       600
     agaaacgcca tcatctcgga tgctatcgat gtgcatttcc agccgatcgt ctcgctgtcc       660
     aacaatcagg tcgtcggctt cgaggcgctc gcccgctgga acgatcccga tctcggcttc       720
     gtgtcgcccg gcgtcttcgt gccgctggcc gaagagcgcg gcttcatcga tgcgctgtcg       780
     gaggcgctgc tgcgcaaagc cgccgaagcc gcactttcct ggccgcgcga actcttcctg       840
     tcgttcaatc tctcctcggc ccagctgatg gatccgggta cgagcagcag cgtcctgtcg       900
     atcctcggcc gcgtcggctt cgatccgcat cgcctggagc tggaaatcac cgagaccgcg       960
     gtgatgagtt cggccgatac cgctcaccgc atcatcgccg atctgcgtgc cgccggtgtg      1020
     cgcatctcgc tcgacgattt cggcaccggc cagtcgagcc tcgggcgcct gcgcgacttc      1080
     atcttcgaca agatcaagat cgaccgcgcc ttcgtctcac gcatcaattc cgatcgcgcc      1140
     tccgaacata tcatcaaggc gatcctcacc atgtgcgaag gcctggagct ggaggtcgtg      1200
     gcggaaggca tcgaggatta tgccgaggcg gtgaagttgc gcacgcttgg ctgcggcatg      1260
     ggccagggtt atcatttcgg ccgtccggcc gacggtatcg ccacgttgcg cttcctgcac      1320
     gagaattatt acgatccgac tatggtggag cgtgtcagcg cataa                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page