(data stored in ACNUC7421 zone)

EMBL: CP001622.PE534

CP001622.PE534       Location/Qualifiers
FT   CDS_pept        complement(565964..566569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0542"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG:
FT                   rec:RHECIAT_CH0000940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54846"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M6"
FT                   /inference="protein motif:PFAM:PF05239"
FT                   /protein_id="ACS54846.1"
FT                   /translation="MTRKLLTTVAAGALFATAFAPAAFSQAAPQPADPAAPTQAAPADP
FT                   AAPKPMTPDVTKPAGDAAQAPAAAPTADTAQAGYLTEQSPDQVSANTYIGQSVYNGNNE
FT                   SIGSVNDLILKKDGGFVAAIVGVGGFLGIGEKNVAVPMEKITVAQNTQDGSVKLTTSET
FT                   AESLKAAPEFKTLAMQSAEKAPAATGTDTTATGSTTPK"
     atgacacgca aactcttgac gaccgttgcc gctggcgcac tgtttgccac ggctttcgca        60
     ccggcggcat tctcgcaggc ggcaccgcag cctgcggatc cggccgcgcc gacccaggcg       120
     gctcccgccg atccggcagc accgaagccg atgacgcccg acgtcaccaa acccgcaggc       180
     gatgccgcac aggctccggc cgcagcaccg acagcagaca cggcacaggc cggctatctg       240
     accgagcagt ctcccgacca ggtcagcgcc aacacctata tcggccagtc ggtctataac       300
     ggcaacaatg aaagcatcgg cagcgtcaac gaccttatcc tgaagaagga cggcggcttt       360
     gttgctgcaa tcgttggtgt cggcggcttc ctcggcatcg gcgagaagaa cgtcgccgtg       420
     ccaatggaaa agattaccgt cgcccaaaac acccaggacg gcagcgtcaa gctgacgacc       480
     agtgaaacgg ctgaatcgct gaaggccgca cctgagttca agacgctggc aatgcagtcg       540
     gccgaaaagg ctccggctgc gaccggtaca gataccacgg cgacaggctc gaccacgcct       600
     aagtaa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page