(data stored in ACNUC7421 zone)

EMBL: CP001622.PE535

CP001622.PE535       Location/Qualifiers
FT   CDS_pept        complement(566803..567690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0543"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: rec:RHECIAT_CH0000941 probable gluconolactonase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54847"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M7"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ACS54847.1"
FT                   /translation="MTDIYEFEGKTLCNTNSVLGEGPTYDPDSNTVWWFNILGKELHEL
FT                   NLSTAAKKVHPLPVMASVLARIDAGRQLIATEEGLFVRDVASGNLTFYAALENDRPENR
FT                   SNDGRTHPSGALWIGTMSKRAENQAGAIYHVASGKVTKIFNGISIPNSICFSPDGTVGY
FT                   YTDSRINRLMRVMVDPLTGLPSGEPIVLVDSMDDPGSIDGSVVDADGYLWNARWGAGVV
FT                   DRYSPDGLRISRYMVPAVQPSCPAFIGVNADRLAVTTAWEGLDEDARSAQPSAGALLEL
FT                   GIDVKGVFDPVYVI"
     atgaccgata tttatgagtt cgagggcaaa acactttgca ataccaattc cgttctcggt        60
     gaaggtccga cctatgatcc ggacagcaat accgtttggt ggttcaacat cctcggcaag       120
     gaactgcacg agctcaatct ctcgacggcc gcgaaaaagg tgcatccgct gcctgtgatg       180
     gcgagcgtgc ttgcccgcat cgatgccggg cggcagctga tcgcgacgga ggaagggctt       240
     ttcgtgcgcg atgtggcaag cggcaacctc accttctacg ccgccctcga aaacgacagg       300
     ccggaaaacc gttcgaacga cggccgcacc cacccgtccg gcgcgctctg gatcggcacg       360
     atgagcaagc gggcggaaaa ccaggccggc gccatctatc atgtcgcgag cggcaaggtg       420
     acgaagatct tcaacggcat cagcatcccg aattcgatct gcttctcgcc tgacggcacg       480
     gttggctatt atacggattc ccgcatcaac cggctgatgc gcgttatggt cgatccgttg       540
     accggcctgc cctcgggcga gccgatcgtg ctcgtcgaca gcatggacga ccccggcagc       600
     atcgacggct cggtcgtcga tgccgacggc tatctgtgga atgcgcgctg gggcgccggc       660
     gtcgtcgacc gctatagtcc ggacggtctg cgcatctcgc gctatatggt tcctgccgtc       720
     cagccgtcct gccctgcctt catcggcgtc aatgccgacc ggctggcggt gacgactgcc       780
     tgggaagggc tcgacgagga tgcgcggtcg gcgcagccga gcgccggcgc gctgctggaa       840
     ctcggcatcg acgtcaaagg cgtgttcgat cccgtctatg taatctga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page