(data stored in ACNUC7421 zone)

EMBL: CP001622.PE536

CP001622.PE536       Location/Qualifiers
FT   CDS_pept        complement(567687..568328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0544"
FT                   /product="KDPG and KHG aldolase"
FT                   /note="PFAM: KDPG and KHG aldolase; KEGG: ret:RHE_CH00853
FT                   2-dehydro-3-deoxy-6-phosphogalactonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54848"
FT                   /db_xref="GOA:C6B2M8"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M8"
FT                   /inference="protein motif:PFAM:PF01081"
FT                   /protein_id="ACS54848.1"
FT                   /translation="MNRIPFPDMKRPLIAILRGIRPDETESVVGALIDNGLTAIEIPLN
FT                   SPEPFKSIEIAAKMAPAEVLIGAGTVLTVEAVDSLHAAGGKLLVTPNVEPEVIIRARDY
FT                   GMVTMPGVFTPTEALAAARAGATGLKFFPASVLGPSGITAIRAILPPELTIAAVGGVSD
FT                   KNFGDYTKAGIFAFGLGTSIYKPGMTASEVAERAKATIYAYDAAIGSVNV"
     atgaaccgta tccccttccc cgacatgaag cgcccgctga tcgccatcct tcgcggcatc        60
     aggcccgacg agaccgaaag cgtcgtcggt gctctgatcg acaatggcct gacggcgatc       120
     gagatcccgc tcaactcgcc ggaaccgttc aaatccatcg agatcgccgc gaagatggcg       180
     ccggccgaag tgctgatcgg cgccggcacg gtgctgaccg tcgaggcggt cgacagccta       240
     catgcggccg gcggcaagct gctggtcacg ccaaatgtcg agcccgaggt gatcatccgg       300
     gcgcgcgact acggcatggt gacgatgccg ggcgtcttta caccgaccga ggcgttggcg       360
     gcagcgcgcg ccggggccac cggtctcaaa ttctttccgg ccagcgtgct cggcccttcc       420
     ggcatcacgg cgatccgggc gatcctaccg ccggaactga cgattgccgc cgtcggcggt       480
     gtctcggaca agaatttcgg cgattatacc aaggccggca tcttcgcctt cggtctcggc       540
     accagcatct acaagccagg aatgactgca tcagaggttg ccgagcgcgc caaggcgacc       600
     atttacgcct atgatgcagc cattgggagc gtgaacgtat ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page