(data stored in ACNUC7421 zone)

EMBL: CP001622.PE537

CP001622.PE537       Location/Qualifiers
FT   CDS_pept        complement(568342..569259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0545"
FT                   /product="2-dehydro-3-deoxygalactonokinase"
FT                   /EC_number="2.7.1.58"
FT                   /note="PFAM: 2-keto-3-deoxy-galactonokinase; KEGG:
FT                   ret:RHE_CH00854 2-dehydro-3-deoxygalactonokinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54849"
FT                   /db_xref="GOA:C6B2M9"
FT                   /db_xref="InterPro:IPR007729"
FT                   /db_xref="InterPro:IPR042257"
FT                   /db_xref="InterPro:IPR042258"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M9"
FT                   /inference="protein motif:PRIAM:2.7.1.58"
FT                   /protein_id="ACS54849.1"
FT                   /translation="MANPAYVAVDWGTSSFRLWLISRDGTVLAERRSGEGMTSAAKIGF
FT                   SAVLAGHLAAIEAPENLPVIVCGMAGARQGWVEAGYIDVPAPLASILTGAVSVPGESRD
FT                   IRILPGLAQRDIARPDVMRGEETQLLGALGRASAGAQAVCMPGTHSKWVHVTDSKVTGF
FT                   STFMTGELFDVISKHTILSHAVAGAEEQPADAAAFEAAVSAAFARPALASNLLFAARSG
FT                   QLLHGISAAAAQARLSGTLIGLEIAGALQDAANGTTITLVASGRLQALYEQAVKTLSLA
FT                   FTAIDADAAVRRGLSAAAEAIWPN"
     atggcaaatc ccgcttatgt cgcggtggac tggggcacca gcagctttcg gctctggctg        60
     atcagcagag acggcaccgt ccttgccgaa cgccgcagcg gcgaaggcat gacgagcgcg       120
     gcaaagatcg gcttttccgc ggtgcttgcc ggccatctcg ccgccatcga ggcacccgaa       180
     aacctgccgg tgatcgtctg tggcatggcc ggcgccaggc agggctgggt cgaggccggt       240
     tatatcgacg tgccggcgcc gcttgcctcg atcctgaccg gagcggtctc cgtgcccggc       300
     gaaagccgcg acatccgcat tctgccgggc cttgcccagc gggacatcgc gaggcccgac       360
     gtcatgcgcg gcgaggaaac ccagcttctc ggcgcgctcg gccgcgcaag cgcgggcgcg       420
     caggcggtct gcatgcccgg cacccattcg aaatgggtgc atgtgacgga tagcaaggtg       480
     accggctttt cgaccttcat gaccggcgag cttttcgacg tcatcagcaa acacacgatc       540
     ctttcgcatg ccgttgccgg tgcggaagag cagccggcgg atgcggcggc cttcgaggcc       600
     gcggtctcgg ccgctttcgc acgtccggcc cttgcctcca acctgctctt tgccgcccgc       660
     tccggtcagc tcctgcacgg gatttctgcg gctgccgcgc aagcccggct ttccggtacg       720
     ctgatcggcc ttgaaatcgc cggggcgctg caggatgcgg caaacggcac caccatcacc       780
     ctcgtcgcct ccgggcgcct gcaggcgctc tacgaacagg ccgtcaaaac cctctccctt       840
     gccttcaccg ccattgacgc cgacgccgcc gtgcgccgcg ggctttcggc tgccgccgaa       900
     gccatctggc cgaattga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page