(data stored in ACNUC7421 zone)

EMBL: CP001622.PE538

CP001622.PE538       Location/Qualifiers
FT   CDS_pept        complement(569259..570032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0546"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ret:RHE_CH00855 3-oxoacyl-(acyl carrier protein) reductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54850"
FT                   /db_xref="GOA:C6B2N0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54850.1"
FT                   /translation="MTMMPAAQFPEFKNRAVLVTGGGSGIGAAIVEGFARQGAKVSFID
FT                   IAEAAGRELAERLSRETTHPVSFHHADLRDIAAIRRTVDSVIASSGPIRVLVNNAAWDD
FT                   RHEFDAVTEAYWDNNQAVNLKHVFFTSQAVVPSMRAAGGGAIINMSSIAFKLNMGGFPA
FT                   YAAAKAAVVGLTKSMAGRLGPENIRVNCILPGMVVTERQMQHWLTEESIARSVEDQCLK
FT                   VALKPDAIVGPCLFLASDCAAAMTAQSLIVDGGVL"
     gtgaccatga tgccagcagc acaatttccc gagttcaaaa accgagccgt gctggtgacc        60
     ggcggcggat cgggcatcgg tgctgcgatc gtcgaaggtt tcgcgcgcca aggcgccaag       120
     gtttcgttca tcgatatcgc cgaggccgcc ggccgcgagc tcgccgaaag gctgtcgcgg       180
     gagaccacgc atccggtctc ctttcaccat gccgacctgc gcgacatcgc ggcgatccgg       240
     cgcacggtcg atagcgtcat tgccagctca gggccgatcc gcgtgctggt caacaatgcc       300
     gcctgggacg accgccatga attcgacgcg gtgaccgagg cctattggga caacaaccag       360
     gcggtcaacc tcaaacatgt gttcttcacc tcgcaggcag tcgtgccgtc gatgcgagcg       420
     gccggcggcg gggcgatcat caatatgtcg tcaatcgcct tcaagctgaa catgggcggc       480
     tttcccgcct atgcggcagc caaggcggcg gtcgtcgggc tgacgaagag catggcgggc       540
     aggctcgggc cggagaacat tcgggtcaac tgcatcctgc ccggcatggt cgtcaccgag       600
     cggcagatgc agcactggct caccgaagag agcattgcgc gctcagtcga ggaccagtgc       660
     ctgaaagtcg cgctcaaacc cgatgcgatc gtcggtccct gcctgtttct tgcatccgac       720
     tgcgcggcgg cgatgaccgc ccagtctctg attgtcgatg gaggtgttct gtaa             774
//

If you have problems or comments...

PBIL Back to PBIL home page