(data stored in ACNUC7421 zone)

EMBL: CP001622.PE539

CP001622.PE539       Location/Qualifiers
FT   CDS_pept        570135..570932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0547"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: Transcriptional regulator IclR; regulatory
FT                   protein IclR; SMART: regulatory protein IclR; KEGG:
FT                   ret:RHE_CH00856 IclR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54851"
FT                   /db_xref="GOA:C6B2N1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N1"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="ACS54851.1"
FT                   /translation="MNSNGDGAAQARETGTLGKLMVLLDLVTHADAPLRFTDILALAGQ
FT                   PRGTLHRQLSHLVEEGLLELDGDGRYAPGLRLLDFAARSWARNEFRLIAEPHLRDLQQA
FT                   TGETVHLGVLRGQSIIYLDKVEGRQPVRMYSQIGNASPCYCTGVGKAALSLLPAESLVD
FT                   LIAGLSFTSFTASTHVSAETLLAEIREIADQGYAFDREEHEAGIRCVAAPVWSEDRTFM
FT                   GGISITGPAYRLSMELLHQWTVPVQLAAVRIMEGMRVRLGPRR"
     atgaattcaa acggcgacgg cgcagcacag gcacgcgaaa ccggcacgct cggcaaactg        60
     atggttctgc tcgatctcgt cacccatgcc gatgcgcccc tgcgtttcac cgacatcctg       120
     gcccttgccg gccagccgcg cggcacgctg catcgccagc tgagccactt ggtggaggag       180
     gggctgctcg agctcgatgg cgacggccgt tatgcgcccg gcctgcgctt gctcgatttc       240
     gccgcgcgca gctgggcgcg caacgaattt cgtctgattg ccgaaccaca ccttagagat       300
     ctgcagcagg cgaccggcga gacggtccat ctcggcgtcc tcaggggcca gtcgatcatc       360
     tatctcgata aggtcgaggg ccgtcagcca gtgcgcatgt attcgcagat cggcaatgcc       420
     tcgccctgtt attgcactgg cgtcggcaag gccgccctgt cgctgctgcc ggccgaaagc       480
     ctcgtcgatc tcatcgccgg cctgagcttc accagcttta ccgcctcgac ccatgtctcg       540
     gccgaaacgt tgcttgccga aatccgcgag attgccgatc agggttatgc cttcgaccgc       600
     gaggagcatg aggccggcat ccgctgcgtt gccgcacccg tttggtcgga ggatcggacc       660
     tttatggggg gcatttcgat taccggcccg gcctatcggt tgtcgatgga acttctgcat       720
     caatggaccg ttcccgttca actggcggct gtcaggatca tggaaggcat gcgcgtccgg       780
     ctcggtccgc gccgctga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page