(data stored in ACNUC7421 zone)

EMBL: CP001622.PE54

CP001622.PE54        Location/Qualifiers
FT   CDS_pept        complement(56302..56892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0055"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rec:RHECIAT_CH0000437
FT                   putative hydrolase protein, MutT/NUDIX family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54366"
FT                   /db_xref="GOA:C6AYE2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE2"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACS54366.1"
FT                   /translation="MNDELKPWSVTASRITYEDRWIRVRSDDCVTADGTVVAPFHVLDY
FT                   PDWINVIPVMPDGRVLLTREYRHGRGEIVLGLVAGSLEPGDSETGDAAMAAARRELREE
FT                   TGYEASTFVKLLTSYPNAASHSNVVTSWLALGLSRAGEPSFDPGEKVELLFTDLAAILG
FT                   DLQSGAVIMQSMHVAALYAAESWLRTQASEGVK"
     atgaacgacg aactgaagcc ctggagcgtg acggcaagcc ggatcaccta tgaggatcgc        60
     tggatccggg tccggagcga cgattgcgtc accgccgatg gaaccgtcgt cgcgccattc       120
     catgtgctcg attatcccga ctggatcaac gtcatccctg tgatgcctga cgggcgcgtg       180
     ctgttgacgc gggaataccg gcacggccgc ggcgagattg tgctcggtct ggtcgccggc       240
     agcctcgaac ccggcgacag cgagaccggc gatgcggcga tggcggcggc ccggcgcgag       300
     ctccgggagg agaccggcta tgaagcttcg accttcgtca agctgctcac ctcctaccca       360
     aatgccgcca gccacagcaa cgtggtgacg agctggctgg cgctgggtct cagccgggcc       420
     ggcgaaccat ctttcgaccc cggagagaag gtcgagctgc tgtttacgga tctagctgcc       480
     atccttggcg acctgcagtc cggcgccgtc atcatgcagt cgatgcatgt cgcggccctc       540
     tatgcggcgg aaagctggct tcgcacacag gcctccgaag gcgtaaaata g                591
//

If you have problems or comments...

PBIL Back to PBIL home page