(data stored in ACNUC7421 zone)

EMBL: CP001622.PE540

CP001622.PE540       Location/Qualifiers
FT   CDS_pept        571190..571924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0548"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: Autoinducer-binding domain protein; regulatory
FT                   protein LuxR; Bacterio-opsin activator HTH domain protein;
FT                   SMART: regulatory protein LuxR; KEGG: rec:RHECIAT_CH0000947
FT                   putative transcriptional regulator protein, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54852"
FT                   /db_xref="GOA:C6B2N2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N2"
FT                   /inference="protein motif:PFAM:PF03472"
FT                   /protein_id="ACS54852.1"
FT                   /translation="MAPLSQTSTEEDDYVQEIAGLKTQFDIFRFMKRVTEAYRSRAFMV
FT                   LNLPPITSFDLQGSTVITSWPAELLALYDQEGLMVNSPVLRRLRTSARPFFYDMSRQNL
FT                   SRDDGKSILVASLFERFKMMRCAYFPTHEPSGLRGAISFAGDREPFSPAEMRELCYISI
FT                   HIFDRLAEIRNLDTRMTDTLTDREIDCLNWTAAGKTSAEIAEILTLSEHTVNHYLNRAT
FT                   KKLDTVNRTQAVAKALRIGLIK"
     atggcaccct tgtcgcaaac atccacggaa gaagacgact acgttcagga aatagcgggc        60
     ctgaagaccc agttcgatat tttccgtttc atgaaacggg tgacggaagc ctatcgcagc       120
     cgtgccttca tggttctcaa cctgccgccg atcacctcct tcgatcttca gggcagcacc       180
     gtcatcacca gctggccggc cgagcttctg gcgctctacg accaggaagg cctgatggtg       240
     aacagcccgg tcctcagacg cctcagaaca tcggcgcggc ccttcttcta cgacatgtca       300
     cggcagaact tgtcgcggga cgacggtaag tccattctcg tcgcctccct gttcgaacgt       360
     ttcaagatga tgcgctgcgc ctatttcccg acgcatgagc cctccggcct gcgcggcgcc       420
     atctctttcg ccggcgaccg cgagcccttc agtccggccg agatgcgtga gctctgctac       480
     atttccatcc atatctttga caggcttgcc gagatccgca acctcgatac gcgcatgacg       540
     gatacgctga ccgaccgcga gatcgattgc ctcaactgga cggcggccgg caagaccagt       600
     gctgaaatcg ccgaaatcct caccctgtcc gagcatacgg tcaatcacta cctcaaccgt       660
     gccaccaaga agctcgacac ggtcaaccgt acccaggcgg tcgccaaggc gttgcgcatc       720
     ggcctgatca aataa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page