(data stored in ACNUC7421 zone)

EMBL: CP001622.PE541

CP001622.PE541       Location/Qualifiers
FT   CDS_pept        572458..573624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0549"
FT                   /product="protein of unknown function DUF59"
FT                   /note="PFAM: protein of unknown function DUF59; KEGG:
FT                   ret:RHE_CH00859 ATP-binding protein (Mrp protein-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54853"
FT                   /db_xref="GOA:C6B2N3"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N3"
FT                   /inference="protein motif:PFAM:PF01883"
FT                   /protein_id="ACS54853.1"
FT                   /translation="MADVTKEQVLETLKTVRGPDLEHDIVELGMVSDVFISDGKVYFSI
FT                   TVPADRAKELEPMRLAAERVIKEMPGVKGALVTLTADKKAAAAAPAARPAANPPHGHAG
FT                   HDHGSHAHAPQQPPRAGKIGVPGIGAIIAVASGKGGVGKSTTAVNLALGLLANGLRVGI
FT                   LDADIYGPSMPRLLKISGRPTQIDGRIINPMENYGLKVMSMGFLVDEETAMIWRGPMVQ
FT                   SALLQMLREVAWGELDVLVVDMPPGTGDVQLTMAQQVPLAGAVIVSTPQDLALIDARKG
FT                   LNMFRKVEVPVLGIVENMSYFIAPDTGTRYDIFGHGGARKEAERIGVPFLGEVPLTMNI
FT                   RETSDAGTPLVASEPNGVVAGIYRGIAAKVWEQVAGQPQRPAPTIVFE"
     atggccgacg tcaccaagga acaagttctc gaaacgctga agacagtgcg tggaccggat        60
     ctcgagcacg atatcgtcga gctcggcatg gtttccgacg tcttcatctc cgacggcaag       120
     gtttatttct ccatcaccgt cccggccgat cgcgccaagg agctggagcc gatgcggctc       180
     gccgccgaac gcgtcatcaa ggaaatgcca ggcgtcaagg gtgccctcgt cacactgacg       240
     gcggacaaga aggccgccgc cgccgctccg gctgcccgcc ctgcggcgaa cccgcctcac       300
     ggtcatgccg ggcacgatca tgggagtcat gctcacgctc ctcaacaacc gccgcgcgcc       360
     ggcaagatcg gtgtgcccgg catcggcgcg atcatcgccg tcgcctcggg caagggtggg       420
     gttggcaagt cgaccaccgc cgtcaatctc gcactcggcc tgctcgccaa cggccttcgt       480
     gtcggcattc tcgatgccga tatctatggt ccctcgatgc cgcggctgct gaagatatcc       540
     ggccgcccga cgcagatcga cggccgcatc atcaatccga tggagaatta tggcctcaag       600
     gtcatgtcga tgggttttct tgtcgacgag gagacggcga tgatctggcg cgggccgatg       660
     gtccagtcgg cgctgctgca aatgctgcgc gaagtcgcct ggggcgaact ggatgtcctc       720
     gtcgtcgaca tgccgcccgg caccggcgac gtccaattga ccatggccca gcaagtgccg       780
     cttgccggcg ccgtcatcgt ctcgacgccg caggatctcg cgctgatcga tgcccgcaag       840
     ggcctcaaca tgttccgcaa ggttgaggtg ccggtgctcg gaatcgtcga gaatatgagc       900
     tatttcatcg ccccggatac cggcacccgc tacgacatct tcggccatgg cggcgcccgc       960
     aaggaggccg agcgcattgg cgtgcccttc ctcggcgaag tgccgctgac gatgaacatc      1020
     cgcgaaacct ccgacgccgg cacgccgctt gtcgcctccg agccgaacgg cgtcgtcgcc      1080
     ggcatctatc gcggcatcgc cgccaaggtc tgggagcagg tcgccggcca gccccagcgt      1140
     ccggcaccga cgatcgtctt cgaataa                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page