(data stored in ACNUC7421 zone)

EMBL: CP001622.PE542

CP001622.PE542       Location/Qualifiers
FT   CDS_pept        574069..575046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0550"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: ret:RHE_CH00860 magnesium/cobalt transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54854"
FT                   /db_xref="GOA:C6B2N4"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N4"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /protein_id="ACS54854.1"
FT                   /translation="MITAYCSNCKSVEIGDLSHAASFPEDVVWIDMIEPTRDEELYVEK
FT                   VLGIEVPTRDDLKDIEPSARLYVENDAVFMTASLLWKADTDVPTLTDVAFILAGNRLVT
FT                   IRYAHPKSFALFIAALHRLPENWRSGAALLAKLLETIVDRTAEILEIAVSRLDILSMHV
FT                   FGERARKVRKPSNYLEEKLRDIAGHHRMISKVRDSLGSLARLLTFFHTIPAIQQDREAK
FT                   ELCRTVSRDIQSLSEHASFVAANITFLLDASLGLINIEQNSIIKIFSIASVVFLPPTLV
FT                   ASVYGMNFQVMPELTWAAGYPYSLALMVISAVIPFFFFRWKGWL"
     gtgattaccg cctactgttc caattgcaag tcggtcgaga tcggcgatct gtcgcatgct        60
     gcgtcctttc ccgaggatgt cgtctggatc gacatgatcg agccgacccg cgatgaggaa       120
     ctctatgttg agaaggttct tggcatcgag gtcccgaccc gcgacgatct caaggatatc       180
     gagccttccg cccgtctcta tgtcgaaaac gacgccgtct tcatgaccgc ctcgctgctc       240
     tggaaggctg acaccgacgt accgacgctg accgatgttg ccttcatcct ggctggaaac       300
     cgcctggtca ccattcgcta cgcccatccc aaatcctttg cgctgttcat cgccgccctc       360
     caccggctgc cggaaaactg gcgcagcggc gctgcccttc ttgccaagct cttggagacg       420
     atcgtcgacc gcaccgccga gatcctcgag atcgccgtct cgcgcctcga catcctgtcg       480
     atgcatgtct tcggcgagcg ggcaaggaag gtgcgtaagc cctcgaacta tctcgaggag       540
     aagctgcgcg atattgccgg ccatcaccgg atgatcagca aggtgcgcga cagtctcggt       600
     tcgcttgccc gcttgctgac gttctttcac acgattccgg cgatccagca ggaccgcgag       660
     gcgaaggagc tttgccgcac cgtctcgcgc gatatccagt cgctgtcgga gcatgcttcc       720
     ttcgtcgccg ccaacatcac cttcctgctc gatgcttcgc tcgggctgat caacatcgag       780
     cagaactcga tcatcaagat tttctcgatt gcctcggtgg tgttcttgcc gccgacattg       840
     gtcgcctccg tctatggtat gaattttcag gtcatgccgg agctgacctg ggccgcgggt       900
     tatccctatt cgctggcctt gatggtgata tccgccgtca tccccttttt ctttttccgc       960
     tggaaaggct ggctctaa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page