(data stored in ACNUC7421 zone)

EMBL: CP001622.PE543

CP001622.PE543       Location/Qualifiers
FT   CDS_pept        575065..576963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0551"
FT                   /product="K potassium transporter"
FT                   /note="PFAM: K potassium transporter; KEGG:
FT                   rec:RHECIAT_CH0000951 potassium transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54855"
FT                   /db_xref="GOA:C6B2N5"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N5"
FT                   /inference="protein motif:PFAM:PF02705"
FT                   /protein_id="ACS54855.1"
FT                   /translation="MSEESHPNERHMTPRKLFYLALGSVGVVYGDIGTSPLYAFREALK
FT                   PVAHDGVTRFEVISLISLMIWALTIIVTIKYVLFLLRADNDGEGGTLSLLALLMKTANG
FT                   HTAILMLLGLMGAALFLGDAMITPALSVLSAVEGLKLVTPRLADYIVPISVVILALLFV
FT                   VQSRGTGAVARFFGPITAVWFLVMAAAGISHISDDYGILAAFNPYYAVSFLLHEGFYGV
FT                   VVLGAVFLTVTGAEALYADLGHFGRRPIQWAWFMLVFPALTLNYLGQGALVLGNPATMS
FT                   DPFYLMFPKWALLPVVILATAATIIASQAVITGAFSMVRQGINLGFLPRMEILFTSETN
FT                   TGQIFVPSVNAVLFIGVIFLVLSFKTSDALATAYGISVTGAMVVTSIMAFEFVRARWNW
FT                   SLPVAVIALAPLVVLEMIFLGANLLKIHDGGYIPIMIATAFTVVMWTWRRGTAILMEKT
FT                   RHTDIPLASFVSSIERKSEHSPAQVPGTAIFLTSDPESAPAALLHNLKHNHVLHDRNVI
FT                   LTIRTINKPRVPSHDRYKIEQISERFSRVELLFGFMESQNVSQALATLRKTGLKFDIMS
FT                   TSFYLGRRKLVPDAKSGMPYWQDRLYIALANAAANPSDYFRLPANRVVELGSHVII"
     atgtccgaag agagccatcc gaacgaacgc catatgacgc cgcgaaagct gttctatctc        60
     gcgctgggtt ccgtcggcgt cgtctacggc gatatcggta ccagcccgct ctatgccttt       120
     cgcgaagcgc tgaagccggt ggcccatgac ggcgttaccc gttttgaagt catcagcctg       180
     atctcgctga tgatctgggc gctgacgatc atcgtcacca tcaaatatgt gctcttcctg       240
     ctacgcgccg acaacgacgg cgagggcggc acgctgtcgc tgctggccct tctgatgaag       300
     accgccaacg gccataccgc catcctgatg ctgcttggcc tgatgggcgc tgccctcttc       360
     ctcggcgatg cgatgatcac cccggctctg tccgtgctgt cggccgtcga gggcctgaaa       420
     ctcgtcacac ccagactcgc ggactatatc gtgccgatct cggtggtgat cctggcgctg       480
     ctcttcgtcg tgcaatcgcg cggcactggc gccgtcgcga ggttcttcgg cccgatcacc       540
     gctgtctggt tcctcgtcat ggccgccgcc ggcatttccc atatctctga cgattacggc       600
     attctggccg ccttcaatcc ctattatgcc gtcagcttcc tgctgcatga gggcttctac       660
     ggcgtcgtcg tgctcggcgc cgtcttcctg acggtgacgg gtgcggaggc gctctatgcc       720
     gatctcggcc atttcggccg tcgtcccatc cagtgggcct ggttcatgct ggttttcccg       780
     gcgctgacgc tgaattatct cgggcagggg gccctcgttc tcggcaatcc ggcgacgatg       840
     tccgatccct tctatctgat gtttccgaaa tgggcgttgc tgccggtcgt catcctggcg       900
     accgccgcga cgatcatcgc cagccaggcg gtcatcaccg gcgccttctc gatggtgcgc       960
     cagggcatca acctcggctt cctgccgcgc atggaaatcc tcttcacctc ggaaaccaat      1020
     accgggcaga tcttcgtgcc ttcggtcaac gcagtgctgt tcattggcgt catcttcctg      1080
     gtcttgagtt tcaagacttc ggatgcgctg gcgaccgcct atggcatctc cgtcaccggc      1140
     gccatggtcg tcacttcgat catggccttc gaattcgtcc gcgcccgctg gaactggtcg      1200
     cttcccgtcg cggtgatcgc gctcgcgccg ctggtggtgc tggaaatgat cttcctcggt      1260
     gccaatcttt tgaagatcca cgacggcggc tatatcccga tcatgatcgc caccgccttt      1320
     accgtcgtca tgtggacttg gcgtcgcggc acggcgatcc tgatggagaa gacccgtcat      1380
     accgatattc cgctcgcctc cttcgtcagc tcgatcgagc gcaagagcga acattcgccg      1440
     gcccaggttc cgggcaccgc gatcttcctg accagcgatc cggaatcggc ccccgccgcc      1500
     ttgctgcata atctcaagca caaccatgtg cttcacgacc gcaacgtcat cctgacgatc      1560
     cgcacgatca acaaaccgcg tgtaccgagc cacgaccgtt acaagataga gcagatttcc      1620
     gagcgtttct cccgcgtcga actgctcttc ggcttcatgg aatcgcagaa cgtctcgcag      1680
     gctttggcga cgctgcgcaa gacaggattg aagttcgaca tcatgtcgac ctccttctat      1740
     ctcggccgcc gcaaactggt gccggacgcc aagtcgggca tgccttactg gcaggaccgg      1800
     ctttacatcg cgctcgccaa cgccgccgcc aacccttcgg actacttccg cctgccggcg      1860
     aaccgggtgg tggaactggg ctcgcacgtt attatttga                             1899
//

If you have problems or comments...

PBIL Back to PBIL home page