(data stored in ACNUC7421 zone)

EMBL: CP001622.PE544

CP001622.PE544       Location/Qualifiers
FT   CDS_pept        577228..578457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0552"
FT                   /product="cell wall hydrolase SleB"
FT                   /note="PFAM: cell wall hydrolase SleB; KEGG:
FT                   rec:RHECIAT_CH0000952 putative cell wall hydrolase protein
FT                   involved in spore germination"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54856"
FT                   /db_xref="GOA:C6B2N6"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N6"
FT                   /inference="protein motif:PFAM:PF07486"
FT                   /protein_id="ACS54856.1"
FT                   /translation="MECSSVPCPESVLRRKSPSRSKLRLFPENWVSPVIFGLAGWLIFP
FT                   SVASHADLAAMLAGLDHEGGNWRMVLTNSPAGSIHQAELAFAEPMVTGSIAADAGMVLP
FT                   DGRKVAFNAKDKGTAKDRGHEDTPDEDRVNRSAKKGRVVAVEKMQPPKDFSAGSILERT
FT                   KMLFTPSFDLKDRSAFVKPKIQGKEIEIATSFYKKQPVVTDNGVPAMLASLVTNNKADV
FT                   LATAYAPAAPDYARQSPFDSILAEPDSGRFVPEIGPRDHAWAASVLAPSVFSAREQQCL
FT                   ASGIYFEARGESVKGQAAVAQVILNRVRNPSYPKTICGVVYQNEDWRNRCQFSFACDSI
FT                   KDRVNSEYHWRVARDVAMAVTSGKIWLLQVGSATHYHAVYVRPKWAKTMEKVGRIGLHV
FT                   FYRTYGGGWS"
     atggaatgtt ccagcgttcc atgcccggag tccgtgttgc gtcgaaagag cccttcccgt        60
     agcaagctgc gtctttttcc cgagaattgg gtgtcccccg taatcttcgg tcttgccggc       120
     tggctgattt tcccgagcgt cgcatcccat gccgatctcg ccgccatgct cgccggcctc       180
     gatcatgagg gtgggaactg gcgtatggta ctgaccaatt ctccggccgg ctccatccac       240
     caggccgaac tcgcctttgc cgagccgatg gtgacgggtt cgatcgcagc cgatgccggc       300
     atggtgctgc ccgatggccg caaggtcgcc ttcaatgcca aggacaaggg cactgccaag       360
     gataggggcc atgaggacac cccggacgag gatcgcgtca atcgcagcgc caagaagggc       420
     cgcgtcgtcg cagtcgagaa gatgcagccg ccgaaggatt tttccgccgg ctcgatcctc       480
     gagcgcacca agatgctctt caccccgagc ttcgatctca aggaccggtc ggccttcgtc       540
     aagccgaaga tccagggcaa ggaaatcgag atcgccacat ctttctataa gaagcagccc       600
     gttgtgaccg ataatggcgt gccggcaatg cttgcaagcc tcgtcaccaa caacaaggcc       660
     gatgtgctgg ccaccgccta tgcaccggca gcacctgact atgcccgcca atcgcccttc       720
     gattcgatcc tggccgagcc ggacagcggc cgcttcgttc cggagatcgg cccgcgcgac       780
     catgcctggg ccgcaagcgt gctggcgccc agcgtctttt ccgctcgcga acagcagtgc       840
     cttgcctccg gtatctattt cgaggcgcgg ggggaatcgg tgaagggcca ggcggccgtc       900
     gcccaggtca tcctcaaccg cgtccgcaac ccttcctatc cgaagaccat ctgcggcgtc       960
     gtctaccaga acgaggattg gcgcaaccgc tgccagtttt ccttcgcctg cgacagcatc      1020
     aaggacaggg tgaattcgga atatcactgg cgagtcgccc gcgacgtggc gatggcggtg      1080
     acatcaggca agatctggct gctgcaggtg ggttcggcga cgcattatca tgccgtctat      1140
     gtcagaccga aatgggcaaa gaccatggaa aaggtcggcc gcatcggtct tcacgtcttc      1200
     tatcgcacct atggtggcgg ctggagctga                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page