(data stored in ACNUC7421 zone)

EMBL: CP001622.PE545

CP001622.PE545       Location/Qualifiers
FT   CDS_pept        578729..579067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0553"
FT                   /product="ATP synthase protein, subunit I"
FT                   /note="KEGG: rec:RHECIAT_CH0000953 ATP synthase protein,
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54857"
FT                   /db_xref="GOA:C6B2N7"
FT                   /db_xref="InterPro:IPR016989"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N7"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000953"
FT                   /protein_id="ACS54857.1"
FT                   /translation="MADDREESLEKRRAQLGAKLATKGVETGEDEAREARAEVSRKGYA
FT                   QAMKLSSEFISAIVVGALLGYLLDRFVGTAPWGLIVLLLLGFCAGVLNVLRSAGVVAHP
FT                   LDDKDDKK"
     atggcggacg accgcgagga aagtctagaa aagcgccgtg cgcaattggg agcgaaactc        60
     gcgaccaagg gcgtcgagac gggagaagac gaggctaggg aagcccgcgc cgaggtaagc       120
     cgcaaaggtt atgcccaggc gatgaagctt tccagcgagt tcatttccgc aatcgtcgtc       180
     ggtgctctgc ttggctatct cctcgaccgt tttgttggca cggcgccttg gggtttgatt       240
     gttcttctgc ttcttggatt ttgtgccggc gttctgaacg tgctgcgttc tgcgggggtg       300
     gttgcccatc ccctggacga caaggacgac aagaaataa                              339
//

If you have problems or comments...

PBIL Back to PBIL home page