(data stored in ACNUC7421 zone)

EMBL: CP001622.PE546

CP001622.PE546       Location/Qualifiers
FT   CDS_pept        579130..579882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0554"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+transporting two-sector ATPase A subunit; KEGG:
FT                   rec:RHECIAT_CH0000954 ATP synthase protein, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54858"
FT                   /db_xref="GOA:C6B2N8"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N8"
FT                   /inference="protein motif:TFAM:TIGR01131"
FT                   /protein_id="ACS54858.1"
FT                   /translation="MSNDPTHQFLIQKIVPIEIGGIDFSFTNASLFMAVSAAAAAGFLY
FT                   FATSNRAIVPGRSQSVAEMSYEFIANMLKEGAGKQGMKFFPLVFSLFMFVLTANLLGMF
FT                   PYFFTVTSQIIVTFALAILVIGTVLVYGFYKHGFHFLNVFVPSGVPGLLLPLVVTIEII
FT                   SFLSRPISLSVRLFANMLAGHITLKVFAGFVASLGTMGALGIGGAVLPLIMTVALTGLE
FT                   FLVAFLQAYVFAVLTCMYLNDAIHPGGH"
     gtgtctaacg atccgactca tcagttcctg atccagaaga ttgtgccgat cgaaatcggc        60
     ggaattgatt tttcgtttac caatgcatcg cttttcatgg ccgtttcggc tgccgctgcc       120
     gcaggcttcc tctatttcgc gacctcgaac cgggccatcg tgccgggccg ttcgcagtcg       180
     gttgcggaaa tgtcctatga attcatcgcc aacatgctga aggaaggcgc gggcaagcag       240
     ggaatgaagt tcttcccgct ggtcttctcg ctcttcatgt tcgtcctgac ggcgaacctg       300
     ctcggcatgt tcccgtattt cttcactgtc accagccaga tcatcgtcac cttcgctctg       360
     gcgattctgg ttatcggtac ggttctcgtc tacggtttct ataagcacgg cttccacttc       420
     ctgaatgtct tcgtgccctc cggcgtgccg ggccttctgc tgccgctggt cgtcacgatc       480
     gaaatcatct ccttcctgtc gcgtccgatt tcactctcgg ttcgtctttt cgccaacatg       540
     ctcgccggtc acatcacgct caaagtgttc gcaggtttcg tcgcctcgct cggaaccatg       600
     ggtgctctcg gtatcggtgg cgccgttctt cccctcatca tgaccgtcgc cctgaccggt       660
     ctcgagttcc tcgtcgcctt cctccaggct tacgtctttg cggtgctgac ttgcatgtac       720
     ctcaacgacg caatccatcc gggcgggcac taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page