(data stored in ACNUC7421 zone)

EMBL: CP001622.PE547

CP001622.PE547       Location/Qualifiers
FT   CDS_pept        579950..580177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0555"
FT                   /product="H+transporting two-sector ATPase C subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase C subunit;
FT                   KEGG: rec:RHECIAT_CH0000955 ATP synthase protein, subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54859"
FT                   /db_xref="GOA:C6B2N9"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2N9"
FT                   /inference="protein motif:PFAM:PF00137"
FT                   /protein_id="ACS54859.1"
FT                   /translation="MEAEAAKYIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADS
FT                   QFGRLVFGFAVTEALGIFSLLVALLLLFAV"
     atggaagcgg aagcagcaaa gtacatcggt gcaggcctgg cttgctttgg tatggccggt        60
     acggctctcg gcctcggcaa tattttcggc agctacctct ccggcgcact gcgcaatccg       120
     tctgccgctg acagccagtt cggccgtctg gtattcggct tcgccgttac ggaagctctg       180
     ggcatcttct cgctgctcgt cgctctcctc ctcctcttcg ccgtctga                    228
//

If you have problems or comments...

PBIL Back to PBIL home page