(data stored in ACNUC7421 zone)

EMBL: CP001622.PE548

CP001622.PE548       Location/Qualifiers
FT   CDS_pept        580255..580878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0556"
FT                   /product="H+transporting two-sector ATPase B/B' subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase B/B' subunit;
FT                   ATPase F0 complex subunit 8; KEGG: rec:RHECIAT_CH0000956
FT                   ATP synthase protein, subunit B'"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54860"
FT                   /db_xref="GOA:C6B2P0"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P0"
FT                   /inference="protein motif:PFAM:PF00430"
FT                   /protein_id="ACS54860.1"
FT                   /translation="MFFVTPAYAEEAPAAATGTDAHAAPAAGEVHTETGVAEGEHARGP
FT                   FPPFDSTTFASQLLWLVITFGVFYLLMQKVIAPRIGTILDQRHTRISQDLEEAGRLKAE
FT                   ADAAVRTYEGELAAARAKSNAIGSAARDAAKAKAEEERRAVEASLSEKIKAAELRIGEI
FT                   KAKAFADVGTIAEETAAAVVDQLIGGTVAKADVAAAVAAAKKEA"
     atgttttttg tgaccccggc ttacgctgag gaagcaccgg cggcagcgac gggtacggat        60
     gcgcacgccg ctccggccgc aggcgaggtc cataccgaga ctggtgtcgc cgaaggcgaa       120
     cacgcccgcg gccctttccc gcctttcgat tcgacgacct tcgcgtccca gctgctctgg       180
     ctggtgatca cgttcggcgt cttctatttg ctcatgcaaa aggtcatcgc gccgcgcatc       240
     gggaccatcc tcgatcagcg tcacacgcgc atttcccagg atctggaaga agcaggccgc       300
     ctgaaggccg aagccgacgc cgccgtccgg acctatgaag gtgaactggc cgctgcccgc       360
     gctaaatcca acgcgatcgg ctccgccgca cgcgacgccg ccaaggccaa ggccgaagag       420
     gaacgccgcg ctgtcgaggc gagcctttcg gaaaagatca aggctgccga gctgcgtatc       480
     ggcgagatca aggccaaggc tttcgccgac gtcggcacca ttgccgagga aacggcggct       540
     gccgtggtcg atcagctgat cggcggcacc gtcgccaagg ccgatgtcgc cgccgccgtc       600
     gcggctgcca agaaggaggc ttga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page