(data stored in ACNUC7421 zone)

EMBL: CP001622.PE549

CP001622.PE549       Location/Qualifiers
FT   CDS_pept        580882..581373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0557"
FT                   /product="H+transporting two-sector ATPase B/B' subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase B/B' subunit;
FT                   KEGG: ret:RHE_CH00867 F0F1 ATP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54861"
FT                   /db_xref="GOA:C6B2P1"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P1"
FT                   /inference="protein motif:PFAM:PF00430"
FT                   /protein_id="ACS54861.1"
FT                   /translation="MEFAFDATFFAFVGLVLFLALVVYLKVPGMMARSLDDRADQIRNE
FT                   LAEAKRLREEAQHLLAEYQRKRKEAEAEAAHIVAAAEREAEMLTAEAKKKTEEFVANRT
FT                   ALSEQKIKQAEVEAMKAVRSAAVDLAIAAAETVLAKRADTKIQSELFGNAVGQVKTRLN
FT                   "
     atggaatttg cctttgacgc gactttcttc gcctttgtcg gcctcgtcct cttcctggcg        60
     ctggtcgttt atctgaaggt tccgggaatg atggcacggt cgctcgatga ccgcgccgat       120
     cagatccgca acgaattggc cgaagccaag cgtctgcgcg aagaggccca gcacctgctt       180
     gccgaatatc agcgcaagcg caaggaagcg gaagccgaag cggcccacat cgttgccgcc       240
     gctgagcgcg aagccgaaat gctgaccgcc gaagcgaaga agaagacgga agaattcgtc       300
     gccaaccgca cggcgctgtc cgagcagaag atcaagcagg ccgaggttga ggcgatgaag       360
     gcggtgcgtt ccgctgctgt cgatctcgca atcgcggccg ctgaaaccgt gcttgccaag       420
     cgggccgata ccaaaatcca gtccgaactc ttcggcaatg ccgtcggcca ggtcaagacc       480
     cggctgaact ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page