(data stored in ACNUC7421 zone)

EMBL: CP001622.PE55

CP001622.PE55        Location/Qualifiers
FT   CDS_pept        57016..57471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0056"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   rec:RHECIAT_CH0000438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54367"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE3"
FT                   /inference="protein motif:PFAM:PF06240"
FT                   /protein_id="ACS54367.1"
FT                   /translation="MDFTGEERIAAPRDIVWAALNDPEIMRGCIPGCQSIERLSPDVFE
FT                   ATIKVKFSLLSATFHGLLTLSNVDAPKSYTLSAEGKGGLAGFARGSADIVLEERGAETI
FT                   LHYRSKAELGGRLAQLGARLLDSTSQKLAEGFFSDFNAAVVAKMAAG"
     atggatttca ccggcgaaga acgcatcgcc gcgccgcggg acatcgtctg ggcagcactc        60
     aacgatcccg agatcatgcg cggctgcatt ccgggttgcc agagcatcga gcggctgtcg       120
     cctgatgtct tcgaggcgac gatcaaggtc aagttcagcc tgttgtccgc caccttccac       180
     gggctgctga cgctttccaa cgtcgatgcg ccgaagagct atacgctgtc ggccgaaggc       240
     aagggcggcc ttgccggctt cgccaggggc agcgccgata tcgtgcttga ggaaaggggt       300
     gccgagacca tcctgcacta ccggtcgaag gccgaactcg gcggcaggct cgcccagctg       360
     ggtgcccgcc tgctcgattc gacctcgcaa aagctcgccg aagggttctt ttcggatttc       420
     aatgccgcgg tcgtcgcgaa gatggcagcg ggttag                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page