(data stored in ACNUC7421 zone)

EMBL: CP001622.PE550

CP001622.PE550       Location/Qualifiers
FT   CDS_pept        581407..581652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54862"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54862.1"
FT                   /translation="MSRPFLLSITRSRAGYLPQINRLQTFGQTRCGPLLSPGASPSSGC
FT                   RHLLPAGGEKGYAAAFSVPRLSLAGHVPSPRLRGEG"
     atgtcccggc cttttctctt gtcgattact cggtctcgtg ccgggtatct gccgcagata        60
     aaccgactgc agacgttcgg gcaaacccgc tgcggtccgc tgctctcacc cggcgccagc       120
     ccctcatccg gctgccgcca ccttctcccc gcaggcgggg agaagggata tgccgcggcc       180
     ttctccgtcc cccgcctatc tctcgcaggg cacgtcccct cgccccgttt acggggagag       240
     ggttag                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page