(data stored in ACNUC7421 zone)

EMBL: CP001622.PE552

CP001622.PE552       Location/Qualifiers
FT   CDS_pept        complement(583112..583801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0560"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: ribonuclease HII/HIII; KEGG:
FT                   rec:RHECIAT_CH0000958 ribonuclease HII protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54864"
FT                   /db_xref="GOA:C6B2P4"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P4"
FT                   /inference="protein motif:PRIAM:3.1.26.4"
FT                   /protein_id="ACS54864.1"
FT                   /translation="MKPRTSPDSPLLFDTAPLVPDFRLELKARKAGHWPVAGADEAGRG
FT                   PLAGPVVAAAVILDPRRIPEGLNDSKQLSAQRREELFVQILATATVSIASSSSTRIDET
FT                   DIRKASLDAMRRAICSLAIPASYVLTDGLDVPPGLDCPGQAVVKGDARSVSIAAASIVA
FT                   KVTRDRMMARAHSVFPDYGFAAHVGYGTAQHRAGIERHGPCSLHRMSFRPLRKTEGAPE
FT                   TDELLSE"
     atgaaacctc gcacgtcacc cgattctccc ctgcttttcg acacggctcc gctcgtgccg        60
     gatttccgac tggaactcaa agcccgcaag gctggccact ggccggtcgc cggcgccgac       120
     gaggcaggcc gcgggccgct ggcgggaccc gtcgtggcgg ccgccgttat tctcgatccg       180
     aggcgcatcc ctgagggtct caacgattcc aagcagcttt cggcgcaacg gcgcgaggaa       240
     ctgttcgtgc agattctggc gactgcgacc gtctccatcg cctcctccag ctcgacgcgc       300
     atcgacgaga cggatatccg caaggcaagc ctcgacgcca tgcgccgggc catctgcagc       360
     ctcgccattc cggcaagtta cgtgctgacc gacgggctcg acgtgccgcc cggcctcgat       420
     tgccccggac aggcggtggt caagggcgat gcccgctcgg tctcgatcgc cgccgcctcg       480
     atcgtcgcca aggtgacgcg tgaccgaatg atggcgcggg cccacagcgt gtttccggat       540
     tacggctttg ccgcgcatgt gggctacggc acggcgcaac accgcgccgg catcgagaga       600
     cacggcccct gctcgctgca ccggatgagc ttcaggccat tgcgtaagac cgagggcgct       660
     cctgagacgg acgagctgct ttccgagtag                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page