(data stored in ACNUC7421 zone)

EMBL: CP001622.PE553

CP001622.PE553       Location/Qualifiers
FT   CDS_pept        complement(583964..585121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0561"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: ret:RHE_CH00869 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54865"
FT                   /db_xref="GOA:C6B2P5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P5"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACS54865.1"
FT                   /translation="MREQSLAGQAAFAPANTADIADAMIVSSGLRVEVDRRRGRGAGLN
FT                   PTGRFEAQQRETVDDGWQTWEELPPFKTEVQVEKPRTAITRNESPDIPFDRSINPYRGC
FT                   EHGCIYCFARPTHAYMGLSAGLDFETKLFAKPDAAKLLERELAKPGYKVRVIAIGTNTD
FT                   PYQPIEKEWRIMRGILEVLNKANHPVSIVTKSAMILRDLDILQEMAAKNLVRVGISVTT
FT                   LDRKLARTMEPRAATPPRRLETIHTLAEAGIQTAVLAAPLIPALNDHELERILESAKAA
FT                   GAAEASYVILRLPLEVSPLFRDWLLQHYPDRYRHVMSLVRSMRGGKDYDAEFGKRMKGA
FT                   GPYAWQIARRFEMAARRFQLTRRSMPLRDDLFVPPDGSGVQLSLL"
     atgagagagc agtccctggc agggcaggcc gcattcgcgc ctgccaatac ggcagatatt        60
     gccgatgcga tgatcgtttc ctccggtctg agagtcgagg tcgatcggcg gcgtggacgt       120
     ggagcgggac tgaacccgac aggtcggttc gaggcgcagc aacgcgaaac cgtcgacgat       180
     ggctggcaga cgtgggaaga gctgccgcca ttcaagaccg aagtgcaggt cgagaagccg       240
     cgcacggcca tcacccgcaa cgaatcgccg gacattccct tcgaccgctc gatcaatccc       300
     tatcgcggct gcgagcacgg ctgcatctat tgtttcgccc gaccgacaca cgcctatatg       360
     gggctttctg cagggctcga tttcgagacg aagctgtttg ccaagcccga tgcggcaaaa       420
     ctcctggagc gggaactcgc caagcccggc tacaaggtgc gggtgatcgc gatcggcacc       480
     aataccgatc cctatcagcc gatcgagaag gaatggcgca tcatgcgtgg cattctcgag       540
     gtgttgaaca aggcgaacca tccggtatcg atcgtcacca agtcggcgat gatcctgcgt       600
     gatctcgaca ttctgcagga gatggcagct aagaacctgg tgcgcgtcgg catctcggtg       660
     accacgctgg atcgcaagct tgcccggacg atggagccgc gagccgccac gccgccgcgg       720
     cggctggaga cgatccacac gcttgccgaa gcaggcatcc agacggctgt gctggccgcc       780
     ccgctcatcc cggcgttgaa cgaccacgaa ctggagcgca tcctcgaatc ggctaaggct       840
     gccggagccg ccgaggcgag ctacgtcatc ctcaggctac cactcgaggt cagcccgctg       900
     tttcgcgact ggctgctgca gcattacccc gatcgttacc ggcatgtgat gtcgctggtg       960
     cgctcgatgc gcggcggtaa ggattacgat gccgaattcg gcaagcgcat gaagggcgcc      1020
     ggcccctatg cctggcagat tgcccggcgc tttgaaatgg ccgcccgacg tttccagctg      1080
     acgcgccgca gcatgccgct gcgcgacgat ctgttcgtgc cgcccgatgg cagcggcgtg      1140
     cagctgtcgc ttctttga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page