(data stored in ACNUC7421 zone)

EMBL: CP001622.PE554

CP001622.PE554       Location/Qualifiers
FT   CDS_pept        585222..585779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0562"
FT                   /product="putative glycosyltransferase protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000960 putative
FT                   glycosyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54866"
FT                   /db_xref="GOA:C6B2P6"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P6"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000960"
FT                   /protein_id="ACS54866.1"
FT                   /translation="MLAKICAAHYKWSMLTVVLECQDQESELAQTLSVLVAGAVEGLVS
FT                   DVVVLDHGSRDGTSRVADAAGCRFHSQWDIKDIVRSARGEWLLFVEPGARPQAGWIDEI
FT                   AEYVALNKLPARFTASRAYRRPFFQRVGRAVPPLELGFLLPKKQALAIAKSGMRLTEFV
FT                   KGQKPRKLASELIPSWVARAAR"
     gtgctggcaa aaatttgtgc ggcgcattat aaatggtcaa tgttgacggt tgttctcgaa        60
     tgtcaggatc aggaatctga gctggcacag actttatcgg tattggtggc aggcgcggtg       120
     gaggggctgg tgagcgatgt ggtcgtgctc gatcacggct cacgcgacgg cacctcgcgg       180
     gtggccgacg ccgccggctg ccgcttccat tcgcagtggg atatcaagga catcgtccgc       240
     tcggcgcgcg gcgaatggct gctcttcgtc gagccgggcg ccagacccca ggccggctgg       300
     atcgatgaga tcgctgaata tgtcgcgctg aacaaattgc cggcgcgctt caccgcatcg       360
     cgtgcctata ggcgcccttt cttccagcgt gtcggccggg ccgtgccgcc gctggaactc       420
     ggctttctcc tgccgaagaa gcaggcgctc gctatcgcca aaagcgggat gcggcttacc       480
     gaattcgtca agggccagaa gccgcgcaag ctcgcgagcg aattgattcc gtcctgggtt       540
     gcccgcgctg cgcgatag                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page