(data stored in ACNUC7421 zone)

EMBL: CP001622.PE555

CP001622.PE555       Location/Qualifiers
FT   CDS_pept        585961..586296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54867"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P7"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00871"
FT                   /protein_id="ACS54867.1"
FT                   /translation="MARGRIYGVRSMIYGLIAVILPTLVIAHPHSAASQMMRSCAGRPE
FT                   IVNFLDKNFAEKLTAVGLINENAILEVYAAESGTWTLIVTDVHGISCVLLSGDSWDTMP
FT                   VLPGLAT"
     atggcacgcg gtaggatcta cggcgtacgc agtatgatct acggcctcat agccgtcata        60
     ttgccgacat tggtgatcgc gcatccgcat tcggctgcat cgcagatgat gcgcagttgc       120
     gcaggccgac ccgaaatcgt caatttcctg gacaagaact tcgccgaaaa gctcacggca       180
     gtcggactaa tcaacgagaa cgccattctt gaggtctatg ccgccgaaag cggcacctgg       240
     accctcatcg tcacggatgt tcacggcata agctgtgttc tgctgtcggg tgacagctgg       300
     gacacgatgc ccgtcctgcc aggcctggcc acatag                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page