(data stored in ACNUC7421 zone)

EMBL: CP001622.PE556

CP001622.PE556       Location/Qualifiers
FT   CDS_pept        complement(586330..586881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0564"
FT                   /product="molybdenum cofactor biosynthesis protein B"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein B;
FT                   molybdenum cofactor synthesis domain protein; PFAM:
FT                   molybdopterin binding domain; KEGG: ret:RHE_CH00872
FT                   molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54868"
FT                   /db_xref="GOA:C6B2P8"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR013484"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P8"
FT                   /inference="protein motif:TFAM:TIGR02667"
FT                   /protein_id="ACS54868.1"
FT                   /translation="MAGLDEKRPFIAVGIAVLTISDTRTPETDKSGDTLAARIREAGHR
FT                   LVDRGIVPDDREKIAARVKAWTENQDIDVVITTGGTGFTGRDVTPEALEPLFEKRMDGF
FT                   SAIFHRISYEKIGTATIQSRATAGVANATFIFVLPGSPGACRDAWDGILKGQLDYRSAP
FT                   CNFVEIMPRLDEHLKRGATK"
     atggcaggtc tggacgaaaa gcgacccttc atcgcggtcg gcattgcggt tttgacgatc        60
     tcggataccc gcacgccgga gacggacaaa tcaggcgaca cgctggcggc gcggatcagg       120
     gaggcggggc acaggctggt cgaccggggc atcgtgcccg atgatcgcga aaagattgcc       180
     gcgcgggtga aggcctggac tgagaaccaa gacatagacg tcgtcatcac cacaggcggc       240
     accggcttta ccggccgtga cgtgacgcca gaggcgctgg agcctttgtt cgaaaagcgc       300
     atggacggct tttccgccat cttccaccgg atctcctacg agaagatcgg cacggcgacg       360
     atccagtcgc gcgccacggc aggtgttgcc aacgccacct tcatcttcgt gctgccgggt       420
     tcgcccggcg cctgccggga tgcctgggac ggcattctga aaggacagct cgactatcgc       480
     agcgcgccgt gcaatttcgt cgagatcatg ccgcggctgg acgagcacct gaaacgcggc       540
     gcgacgaagt ag                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page