(data stored in ACNUC7421 zone)

EMBL: CP001622.PE557

CP001622.PE557       Location/Qualifiers
FT   CDS_pept        complement(586881..587792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0565"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; GHMP kinase domain protein;
FT                   KEGG: ret:RHE_CH00873
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54869"
FT                   /db_xref="GOA:C6B2P9"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2P9"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ACS54869.1"
FT                   /translation="MMSSENRSHFSASCSSFSEEARAKINLALHVTGQRPDGYHLLDML
FT                   VTFADHGDRLDFMRSPTDALTLSGRFGETLAGDGGTNLVLKARDLLREVVGPLAFPVRI
FT                   HLEKNLPIASGIGGGSADAAATLRGLMRLWGTTLSAETLAALALKLGADVPMCLESRPL
FT                   IARGIGEKIEPVPDLPAFAMVLANPLKGVATPEVFRRLATKNNPALSLALSGSQAADWL
FT                   AAIAAARNDLEPPARGLVPEIAAISAMLQARGALLTRMSGSGATCFGIFASMTAAEGAA
FT                   AALHDKRPDWYFQATETVSGGA"
     atgatgtcgt ccgaaaaccg ctcacacttt tcggcatcat gctctagctt ttccgaggaa        60
     gcacgcgcga aaatcaacct cgccctgcat gtgacgggcc aacggccgga tggctatcat       120
     ctgctcgata tgctggtgac cttcgcagat cacggcgatc ggctggactt catgcggtcg       180
     ccgaccgacg cattgaccct gtccggccgt tttggcgaaa cgcttgccgg cgacggcggc       240
     accaacctgg tgctgaaggc ccgcgacctt ctgcgtgagg tggtcggtcc cctcgccttt       300
     cccgtccgca tccatttgga aaagaacctg ccgatcgcct ccggcatcgg cggcggctcg       360
     gccgatgcgg ccgcgacgct gcgcgggctg atgcggctct ggggcacgac gttatctgcg       420
     gagacgctcg cagcattggc tctgaagctc ggcgccgacg tgccgatgtg cctggagagc       480
     cggccgctga ttgcccgcgg catcggcgaa aagatcgaac cggtgcctga tctgccggcc       540
     tttgccatgg tgcttgccaa tccgctgaag ggcgtcgcga cgcctgaggt tttccgccgg       600
     ctggcgacaa agaacaatcc ggccctgagc ctggctttga gcgggtctca ggctgccgac       660
     tggctcgcgg cgattgctgc tgcccgcaac gacctggagc cgccggcgcg cggactcgtg       720
     cccgagattg cggcgatctc ggcgatgctg caggctcgcg gcgccctgtt gacccgcatg       780
     tccggttccg gcgccacctg tttcggcatc tttgcgagca tgactgctgc cgaaggtgcg       840
     gcggcagctc ttcacgacaa gcgccctgac tggtatttcc aggcgacaga aacggtttcg       900
     ggaggcgcgt ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page