(data stored in ACNUC7421 zone)

EMBL: CP001622.PE558

CP001622.PE558       Location/Qualifiers
FT   CDS_pept        complement(587844..589676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0566"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG:
FT                   rec:RHECIAT_CH0000964 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54870"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q0"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACS54870.1"
FT                   /translation="MRQRLAIRLLTSAALAAVLSLSGVGGANAEDAAKTDDAGTAVHFD
FT                   ADSVTTFSGAFLAARTADVDHDYETAIELYKKALQIEPGNPEIRQRLMISLLLNGDIKD
FT                   GVKYANDLKGDPSVERITTIVRGMDAVRRDDYKSAEAILKYKGPNDLDRMMNDLLLAWA
FT                   RVGAGRGKEALTMVEKMKGPDWFRIFQNYNAGAIAIVTGDVKSARQHLNDAVLDKEGGA
FT                   TAPDTFMRAVMALARLEATQGNKQKALDAVSVGDNLLPNYAPLNALRDSIEKNEKQDQQ
FT                   VKTAEEGAAGVLFSVGGALNRDGAEDIVSLYLQTANALDPNSADTLVLLGGIAEKQNQM
FT                   DRAIALYKKVPENSPMRRISELQLGLALAQGGKVDEARKHLQALITSDPKDIRSYLAYG
FT                   SVLSDAKDYQAMATNYDKAVETIGPIPGRANWSVFFQRGIAYERLKKWDQAEPNFRKAL
FT                   ELNPDQPQVLNYLGYSWIDMNRNLDEGLGMIKKAVDLRPDDGYIIDSLGWAYFRLNRFD
FT                   DAVDELERAAQIKAGDATINDHLGDAYWRVGRKLEAVYQWNRALASEPEAAEIPKIKDK
FT                   VANGLPPASDDAKAADKKQPDPAPVTPPPVDKKS"
     atgcggcaga gacttgccat ccgtcttctt acgagcgcag cgcttgccgc tgtcctttcg        60
     ctcagcggtg tcggcggcgc gaacgccgag gatgcggcca agacagacga tgccggcacg       120
     gccgttcact ttgatgcgga cagcgtcacc actttctccg gcgccttcct cgccgcgcgc       180
     acggccgatg tcgatcatga ctacgaaacc gcgatcgaac tctacaagaa ggcgctgcag       240
     atcgagcccg gcaatcccga gattcgccag cggctgatga tctcgctgct gctaaatggc       300
     gatatcaagg acggcgtcaa atatgccaac gacctgaagg gcgatccttc cgtcgagcgc       360
     atcaccacga tcgtgcgcgg catggatgcc gtgcgccgcg acgactacaa gtccgccgag       420
     gccatcctga aatataaggg gccaaacgat ctcgaccgga tgatgaacga cctgctgctc       480
     gcctgggccc gcgtcggcgc cggccgcggt aaggaagcgc tcaccatggt cgagaagatg       540
     aagggcccgg actggttccg catcttccag aattacaatg ccggcgcgat cgccatcgtc       600
     accggcgacg tgaaatccgc ccgccagcat ctgaacgatg ccgtgctcga caaggaaggc       660
     ggcgcgacgg cgcccgacac cttcatgcgc gccgtgatgg cgcttgcccg cctcgaagca       720
     acacaaggca ataagcagaa ggcgctcgac gccgtttccg tcggcgacaa cctgctgccg       780
     aattatgcgc cgctgaacgc gttgcgcgac agtatcgaga agaacgagaa gcaggaccag       840
     caggtcaaga cggccgaaga gggtgctgcc ggcgtgctct tttcggtcgg cggcgcgctg       900
     aaccgcgacg gcgccgaaga catcgtctcg ctgtatctgc agacggccaa tgcgctcgat       960
     ccgaacagcg ccgatacgct ggtgctgctt ggcggcattg ccgagaagca gaaccagatg      1020
     gaccgcgcca tcgcgctcta caagaaggtg ccggagaatt cgccgatgcg gcgcatctcc      1080
     gagctgcagc tcggccttgc gcttgcccag ggcggcaagg tggatgaggc gcgcaagcac      1140
     ctgcaggcgc ttatcacctc cgacccgaag gacatccgca gttacctcgc ttatggcagc      1200
     gtgctctccg acgccaagga ctaccaggcg atggccacga attacgacaa ggccgtcgaa      1260
     acgatcggcc ccattcccgg ccgcgccaac tggagcgtct tcttccagcg cggcatcgcc      1320
     tatgagcggc tgaagaagtg ggaccaggcg gaaccgaact tccgcaaggc gctggagctc      1380
     aatcccgacc agccgcaggt gctgaattat ctcggctatt cctggatcga catgaaccgg      1440
     aacctcgatg aaggtctcgg catgatcaag aaggccgtcg accttcgccc tgacgacggc      1500
     tacatcatcg attcgctcgg ctgggcctat ttccgcctca accgcttcga cgatgccgtc      1560
     gacgagctgg agcgggccgc acagatcaag gccggcgacg cgacgatcaa cgaccatctc      1620
     ggcgatgcct attggcgcgt cgggcgcaag ctcgaggccg tctaccagtg gaaccgggcg      1680
     ctcgcctccg agcccgaagc tgccgagatc ccgaagatca aggacaaggt cgccaacggc      1740
     ctgcctcccg ccagtgacga tgccaaggcg gccgacaaga agcagccgga tccggcgccc      1800
     gtcaccccgc cgccggtcga caagaaatcc tga                                   1833
//

If you have problems or comments...

PBIL Back to PBIL home page