(data stored in ACNUC7421 zone)

EMBL: CP001622.PE559

CP001622.PE559       Location/Qualifiers
FT   CDS_pept        complement(589810..590826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0567"
FT                   /product="Farnesyltranstransferase"
FT                   /EC_number="2.5.1.29"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: ret:RHE_CH00875
FT                   octaprenyl-diphosphate synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54871"
FT                   /db_xref="GOA:C6B2Q1"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q1"
FT                   /inference="protein motif:PRIAM:2.5.1.29"
FT                   /protein_id="ACS54871.1"
FT                   /translation="MGVVIPLEESKNKLASIKPLVDLTRADMERVNQLILSKAGSDVQM
FT                   IPEVANHLISSGGKRLRPMLTLASASLFDYRGENHVKLATSVEFMHTATLLHDDVVDES
FT                   DLRRGKSTARMIWGNQASVLVGDFLLGQAFRMMVDVGSLDALDVLSSAACVIAEGEVLQ
FT                   LSVAKNMETTEDDYLSVIRAKTAALFAAAAEVGPIVAEAGRSGRNALKSYGMNLGLAFQ
FT                   LVDDALDYGGKAADLGKNVGDDFREGKITLPVILAYRRGTEDERAFWRDAIEAGNSTDA
FT                   NLEKALGLITKYGTLSDTIGRAIHYGTIARDALAPLPDTVWKSALMEVIDFCIERVN"
     ttgggcgtgg tcataccgct tgaagaaagc aaaaacaaac tggcatccat aaagccgctg        60
     gtcgatctca ccagggcgga tatggagcga gtaaaccagc tcattctgtc taaggccggc       120
     tccgacgtgc agatgatccc cgaagtggcg aaccatctga tctcgtccgg cggcaagcgg       180
     ctacggccga tgctgacgct ggcttccgcc tcgctgttcg actacagggg cgaaaaccac       240
     gtcaagctcg ccacatcggt cgagttcatg cacacggcaa cgctgctgca cgacgatgtc       300
     gtcgacgaaa gcgatctgcg ccgcggcaaa tcgacggcgc ggatgatctg gggcaaccag       360
     gcaagcgtgc tggtcggcga cttcctgctc ggccaggcct tccggatgat ggtcgatgtc       420
     ggctcgctcg atgcgctgga tgtcttgtct tccgccgcct gcgtgatcgc cgaaggcgag       480
     gtgctgcagc tttccgtcgc caagaacatg gagacgacgg aggacgatta tctctccgtc       540
     atccgcgcca agacggcggc tctctttgcc gccgccgccg aagtcgggcc aatcgtcgcc       600
     gaggccggcc ggtccggccg caatgcgctg aaatcctacg gcatgaatct cgggctcgcc       660
     ttccagctgg tcgacgacgc gctcgactat ggcggcaagg cggccgatct cggcaagaat       720
     gtcggcgacg atttccgcga gggcaagatc accctgccgg tcattctcgc ctatcgccgc       780
     ggcaccgagg acgagcgcgc cttctggcgc gatgcgatcg aagccggcaa cagcactgac       840
     gcaaacctcg aaaaagcgct ggggctgatc accaaatatg gcacgctgag cgacacgatc       900
     ggccgcgcga tccattacgg cacgatcgca cgggatgcgc ttgcgcccct tcccgatacg       960
     gtctggaaat ccgccctgat ggaagtgatc gacttctgca tcgagcgcgt caattga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page