(data stored in ACNUC7421 zone)

EMBL: CP001622.PE56

CP001622.PE56        Location/Qualifiers
FT   CDS_pept        57506..57943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0057"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rec:RHECIAT_CH0000439 putative acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54368"
FT                   /db_xref="GOA:C6AYE4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACS54368.1"
FT                   /translation="MMTWTIRPPRAEDQEILAEIYLSVRRETFVWVDPGKFHREDFAAH
FT                   TNGETVFVCAHENGRVAGFLSLWPADDFIHMLYISPEFQGQGAGKALLQALPEWPQHRY
FT                   RLKCLVKNRRAKAFYLSHGFHVTGNGTSPEGDYEELSFFPA"
     atgatgacgt ggaccatcag gccgccgcgg gcggaagacc aggaaatact cgcggagatt        60
     tatctttccg tacgccgcga aacattcgtc tgggtcgatc ccggcaaatt ccatcgcgag       120
     gatttcgctg cccataccaa tggcgagacg gtcttcgtct gcgcgcatga aaacggccgc       180
     gttgccggct tcctgtcgct ctggccagcc gatgatttca tccacatgct ctatatcagc       240
     cctgaatttc agggccaggg tgccggtaag gcgctgctgc aggcgctgcc ggaatggccg       300
     caacaccggt accggctgaa atgcctggtg aagaaccggc gggcaaaggc gttctacctt       360
     tcccacggtt tccacgtgac cggcaacggc acctcgccgg agggcgacta cgaggaactg       420
     agcttttttc cggcttga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page