(data stored in ACNUC7421 zone)

EMBL: CP001622.PE560

CP001622.PE560       Location/Qualifiers
FT   CDS_pept        590935..591162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0568"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000966 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54872"
FT                   /db_xref="GOA:C6B2Q2"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q2"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000966"
FT                   /protein_id="ACS54872.1"
FT                   /translation="MHELIRANDPVLLSFAESLMKDAGIHCFIADQGMSVLEGSLGMLS
FT                   RRLLVDEEMADQARRILTDAGLGGELRERK"
     atgcatgagc ttatccgcgc caacgacccc gttctgctct cctttgccga gagtttgatg        60
     aaggatgccg gaattcactg cttcatcgcc gatcagggca tgagcgtgct ggaaggctcg       120
     ctcggcatgc tgtcgcgccg cctgctggtg gatgaggaga tggccgatca ggcgcgccgc       180
     atcctcaccg atgccggtct cggcggcgag ctgcgcgagc ggaagtga                    228
//

If you have problems or comments...

PBIL Back to PBIL home page