(data stored in ACNUC7421 zone)

EMBL: CP001622.PE561

CP001622.PE561       Location/Qualifiers
FT   CDS_pept        591169..591939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0569"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG:
FT                   rec:RHECIAT_CH0000967 putative methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54873"
FT                   /db_xref="GOA:C6B2Q3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q3"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ACS54873.1"
FT                   /translation="MTATDTVDAFHRGGFHVVQPKGRGHRSGMDAMLLAALVADDRPVR
FT                   VADLGAGAGAAGLAVASRLANTQVVLFERSAEMADYARRSILLPDNAHLAGRVSVVEAD
FT                   VTLTAKARNDAGLTDESFHHVIMNPPFNDAGDRRTPDALKAEAHAMTDGLFESWIRTAG
FT                   AIIIPGGQLSLIARPQSIAEIVAACGRRFGGIEITAIHPRQGENAVRILVTGIKGSRAR
FT                   LSLRAALIMHEEGSHKFSPLVDDFNNGRAAYARL"
     atgaccgcca ctgacactgt cgatgccttt catcgcggcg gcttccatgt ggtgcagccg        60
     aagggcaggg gtcatcgctc cggcatggat gcgatgctgc ttgcggcgct cgtcgccgac       120
     gatcgtccgg tcagggtcgc cgatctcggc gccggcgccg gcgctgccgg ccttgccgtc       180
     gcctcgcggc ttgccaatac gcaagtcgtg cttttcgagc gctcggccga gatggccgat       240
     tatgcccgcc gcagcatcct cttgcccgac aatgcccatc tcgccggccg cgtcagcgtc       300
     gtcgaggccg atgtgacgct gaccgccaag gcgcgcaacg atgccgggct caccgatgag       360
     agcttccacc acgtcatcat gaacccgccc ttcaacgacg ccggcgaccg gcgcacaccg       420
     gacgcgctga aggccgaagc ccatgcgatg accgacggcc tgttcgaaag ctggatccgc       480
     accgccggcg ccatcataat cccaggcggg caattgtcgc tgatcgccag gccacagtcg       540
     atcgccgaga tcgtcgccgc ctgcggccgg cgcttcggcg gcatcgagat caccgccatc       600
     catccgcgtc agggtgaaaa cgccgtgcgg atactggtga ctggtatcaa gggatcgcgg       660
     gcgcggctgt cgctgcgtgc ggccctcatc atgcacgaag aggggagcca caagttctcc       720
     cctctcgttg atgatttcaa taatggccgg gcggcctatg ccaggcttta g                771
//

If you have problems or comments...

PBIL Back to PBIL home page