(data stored in ACNUC7421 zone)

EMBL: CP001622.PE562

CP001622.PE562       Location/Qualifiers
FT   CDS_pept        complement(591970..593310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0570"
FT                   /product="Mn2+/Fe2+ transporter, NRAMP family"
FT                   /note="TIGRFAM: Mn2+/Fe2+ transporter, NRAMP family; PFAM:
FT                   natural resistance-associated macrophage protein; KEGG:
FT                   ret:RHE_CH00878 manganese transport protein MntH"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54874"
FT                   /db_xref="GOA:C6B2Q4"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q4"
FT                   /inference="protein motif:TFAM:TIGR01197"
FT                   /protein_id="ACS54874.1"
FT                   /translation="MDALNPNAKNGWRHERGEASLSDVYRTVGTGRHSSRWRRAAAFAG
FT                   PGYMVAVGYMDPGNWATSLAGGSKFGYALLTVALLSNLMAIVLQSLCARLAIASGRDLA
FT                   QACRDAFPKYVSLPLWAFAEIAIIATDIAEVIGTAIGLNLLMGIPLELGVLITALDVFV
FT                   ILFLQKLGFRWVEAFIIALLGVIAVCFGVQILLADPQWGAVLTGFFPTTEIVTNPEMLY
FT                   LALGILGATVMPHNLYLHSGIVQTRAYGHTVPEKREALTFATIDSTVALCFALLINASI
FT                   LILAAAAFNAHGKTDVVELGDAYSLLSPLLGLAIAPTLFGIALLCCGLNSTVTATLAGQ
FT                   IVMEGFLKIRLKPWVRRLITRAIAIVPAAIVTIWYGDQGTAELLILTQVVLSLQLSFAV
FT                   FPLVMFTANKAKMGELVAPRWLSGVAYLIAIVIAGLNVKLLFDFVTG"
     atggacgccc tcaatccgaa tgcaaagaac ggctggcggc acgaacgcgg agaagcgtcg        60
     ctgtcggatg tttaccgcac cgtcggtact gggcgtcaca gctcgagatg gcgaagggcg       120
     gcagccttcg ccggaccggg ctacatggtc gccgttggct atatggaccc cggcaactgg       180
     gcgacctcgc tcgccggcgg ctcgaaattc ggctatgcgc tgctcaccgt cgctctgctt       240
     tccaacctga tggcgatcgt gctgcaatcg ctctgcgcgc gcctggcgat cgcctccggc       300
     cgcgacctcg cccaggcctg ccgcgacgcc tttccgaaat atgtctcgct gccgctctgg       360
     gcctttgcgg aaatcgccat catcgccacc gatatcgccg aggtgatcgg cacggcgatc       420
     ggcctcaacc tgttgatggg catcccgctc gaactcggcg tgctgatcac cgcgctcgac       480
     gtcttcgtga tcctcttcct gcagaagctc ggcttccgct gggtggaagc cttcatcatc       540
     gcgctgctcg gcgttatcgc cgtctgcttc ggcgtgcaga tactgctggc cgacccgcaa       600
     tggggcgcgg tcctcaccgg cttcttcccg acgacggaga tcgtcaccaa tcccgagatg       660
     ctctatctgg cgctcggcat tctcggcgcg accgtcatgc cgcacaatct ctacctccac       720
     tccggtatcg tgcagacgcg ggcctatggc catacggttc ccgaaaagag ggaggcgctc       780
     acctttgcga cgatcgactc gaccgtcgcg ctctgtttcg cgctgctgat caacgcctcg       840
     atcctgatcc tggctgccgc cgccttcaat gcgcacggca agactgacgt cgtcgaactc       900
     ggcgatgcct attcgctgct gtcgccgctg ctcggcctcg ccatcgcgcc gacgctgttc       960
     ggcatcgcgc ttctctgctg cggtctcaac tcgacggtga cggcgacgct tgccggccag      1020
     atcgtcatgg aaggcttcct caagattcgg ctgaagccgt gggtgcgccg cctgattacc      1080
     cgggccatcg ccatcgtgcc ggcagcgatc gtcaccatct ggtatggcga ccagggcacg      1140
     gcagagcttt tgatcctgac ccaggtggtg ctcagcctgc agctttcctt cgccgtcttc      1200
     ccgctggtga tgttcaccgc caacaaagcc aagatgggtg aactcgtggc accgcgctgg      1260
     ctgagtgggg ttgcgtatct gatcgcgatc gtcatcgccg ggctgaacgt caagctgctc      1320
     ttcgacttcg tcaccggctg a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page