(data stored in ACNUC7421 zone)

EMBL: CP001622.PE563

CP001622.PE563       Location/Qualifiers
FT   CDS_pept        593480..594340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0571"
FT                   /product="peptidase S49"
FT                   /note="PFAM: peptidase S49; KEGG: ret:RHE_CH00879 protease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54875"
FT                   /db_xref="GOA:C6B2Q5"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q5"
FT                   /inference="protein motif:PFAM:PF01343"
FT                   /protein_id="ACS54875.1"
FT                   /translation="MAGFLRKLLPKRFRKDGITIPVVRLQGAIISGGGQFRPTLNLANV
FT                   SPVLEKAFAMKDAPAIAISINSPGGSPVQSRLIFTRIRELAREKQKKVLVFVEDVAASG
FT                   GYMIALAGDEIIADATSIVGSIGVVSGGFGFPELLKKIGVERRVYTAGENKVILDPFQP
FT                   EKEKDIEYLKSLQLEIHQVFISMVRERRASKLRDDATVFSGLFWSGTRGLELGLIDGLG
FT                   DMRQELKRRYGQKTKLELVTAGRGLFGRRIPGVSPVSLEDAASGLATGLVEAAEERALW
FT                   SRFGL"
     atggccggat tcttgagaaa actgctgccg aaacggttcc gcaaggacgg catcaccatt        60
     ccggtcgtcc ggctgcaagg ggcgattatc agcggcggcg gccagttccg accgaccctc       120
     aatctcgcca atgtctctcc ggttctggaa aaggccttcg ccatgaagga cgcgccggcg       180
     atcgccatct ccatcaattc gccgggcggc tcgcccgtcc agtcgcgcct gatcttcacc       240
     cgcattcgcg agctcgcccg tgagaaacag aagaaggttc tggtcttcgt cgaggatgtc       300
     gctgcctccg gcggttacat gatcgcgctt gccggcgacg agatcattgc cgacgccacc       360
     tccatcgtcg gctcgatcgg cgtcgtttcc ggcggtttcg gctttcccga actcttgaag       420
     aagatcggcg tcgaacgccg cgtctatacg gcgggcgaaa acaaggtgat cctcgatccc       480
     ttccagccgg aaaaggaaaa ggatatcgag tatctgaaga gcctgcagct cgaaatccac       540
     caggtcttca tctccatggt gcgcgaacgt cgcgccagca agctgaggga cgatgcgacg       600
     gtattttccg gcctgttctg gagcggcacg cgcggcctcg aactcggcct catcgatggc       660
     ctcggcgata tgcgccagga attgaagagg cgctacggcc agaagaccaa actggagctc       720
     gtcaccgccg gccgcggcct gttcggccgc cggattccag gtgtgtcgcc ggtttcgctc       780
     gaggacgctg catccggtct cgcgacaggg cttgtcgaag cggcggaaga aagagcattg       840
     tggagccgtt tcgggctttg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page