(data stored in ACNUC7421 zone)

EMBL: CP001622.PE565

CP001622.PE565       Location/Qualifiers
FT   CDS_pept        594938..595873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0573"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: ret:RHE_CH00881 glycyl-tRNA synthetase subunit
FT                   alpha; TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54877"
FT                   /db_xref="GOA:C6B2Q7"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q7"
FT                   /inference="protein motif:TFAM:TIGR00388"
FT                   /protein_id="ACS54877.1"
FT                   /translation="MNPKRSFQALILTLHNYWADKGCAVLQPYDMEVGAGTFHPATTLR
FT                   ALGPKPWKAAYVQPSRRPSDGRYGENPNRLQHYYQYQVILKPNPPNLQELYLGSLAAIG
FT                   LDPLLHDIRFVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIECSPVAGELTY
FT                   GLERLAMYVQGVDNVYDLNFNGRDGDEKISYGDVFLQAEQEYSRHNFEFANTEMLHRHF
FT                   VDAEKECRALLDAGAPGDNANQRLHKCVFPAYDQCIKASHVFNLLDARGVISVTERQSY
FT                   ILRVRTLAKACGEAFLLTDAGGVNLSKEAA"
     atgaacccga agcgctcctt ccaggcgctg atcctgaccc tgcataatta ctgggcggac        60
     aagggttgcg cggtgctgca gccctatgac atggaagtcg gcgccggcac cttccaccct       120
     gccaccacgc tgcgcgccct cggccccaag ccctggaagg ccgcttacgt ccagccgtcg       180
     cggcgcccgt ccgacggccg ctatggcgaa aacccgaacc ggctgcagca ttattaccaa       240
     taccaggtca tcctgaagcc gaacccgcca aacctgcagg agctttatct cggctcgctg       300
     gcggcgatcg gtctcgatcc gctgctgcat gacatccgct tcgtcgagga tgactgggaa       360
     agcccgacgc tcggcgcctg gggcctcggc tgggaatgct ggtgcgacgg catggaagtc       420
     tcgcaattca cctatttcca gcaggtctgc ggtatcgaat gctcgccggt cgctggcgaa       480
     ttgacctatg gtctcgaacg gctcgccatg tatgtccagg gcgtcgacaa tgtctacgac       540
     ctgaacttca acggccgcga cggcgacgaa aagatcagct atggcgatgt cttcctgcag       600
     gccgagcagg aatattcgcg tcataatttc gagttcgcca ataccgagat gctgcaccgc       660
     catttcgtcg atgccgagaa ggaatgccgg gcgctgctcg atgccggcgc ccccggcgac       720
     aacgccaacc agcgcctgca caaatgcgtc ttcccggcct atgaccagtg catcaaggca       780
     agccatgtct tcaacctgct cgacgcccgc ggcgtcatct cggtcaccga gcgccaaagc       840
     tatatcctgc gcgttcgcac gcttgccaag gcctgcggcg aagcctttct gctgaccgac       900
     gccggcggcg tcaatctctc gaaagaggcg gcgtaa                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page