(data stored in ACNUC7421 zone)

EMBL: CP001622.PE566

CP001622.PE566       Location/Qualifiers
FT   CDS_pept        595968..597791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54878"
FT                   /db_xref="GOA:C6B2Q8"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q8"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000973"
FT                   /protein_id="ACS54878.1"
FT                   /translation="MASVSLLKSGILYFKLLYENSAPRMLRLLAWPILCAMLFVLTSCS
FT                   NFDKEFTVYSANTTIEVYTDGSAFVSEHFDILVKKAENYGGVYVDIPQRFTDASGGVHW
FT                   RDFELAAARRDGIDEYYFKENNVPGYSVYIGAEHCKSCSADLLTGVTKIQIAYWLGRLV
FT                   RQEGDHEVLFLPAYMGRVHGQGAKKTLTLKLPPGGTVRPSQQDRAAGYDITRSAPNEIL
FT                   VSIPVGKADRKLPDIEIEYPAGTFVTVTSGERVQWWLSDHFLPFISILGPLIAGLFVLM
FT                   RLGQGWRLPAPSIAGDSKKTESISPALAAYVFWNWKPDTAKAAFMASVCHLATKRLLRI
FT                   SGLGENAEASDLSARQVRKKGKVARARWYGLPAVTRSVFGRIEGERPVNDRRTVVYALY
FT                   GFERDLHQIVAEEYWKVRGGADRAALTTSATILVLGIATAYLSGLLIFSAAICGILLIV
FT                   FLVVTMFRHPERFPVATGTSEQFKQAISLFVGLPAILIVALCYIGTTEVIGEQQPYLVA
FT                   ILLHIAGIIAVLAMLRMPTSKQRQIRNHILSLHRYFHGEIDGPPMSIECYEHHLPFAVA
FT                   LGVEQRWTERFNLWRESEKMDAYAPDWRISS"
     atggcttcgg tatctctttt gaagagcggt attctttact ttaaactttt gtatgaaaat        60
     tccgccccca ggatgttgcg ccttttagca tggcccatct tatgcgccat gctgttcgtc       120
     ctgacttcgt gcagcaattt cgacaaagaa ttcaccgtct attcggcaaa cactacgatc       180
     gaagtctata ccgacggcag tgcgtttgtg tcggaacact tcgacatttt ggtcaaaaag       240
     gcggaaaatt acggcggcgt ctacgttgat atccctcaac gtttcacgga tgcgtcaggt       300
     ggtgttcact ggcgcgattt cgaactggcc gcagcccggc gtgacggaat cgacgaatat       360
     tatttcaaag aaaacaatgt gccgggctat tcggtttaca taggagcgga gcactgcaaa       420
     agctgttctg cagatctgct caccggtgtt acaaagatcc agatcgctta ctggctcgga       480
     cgcctggttc gtcaggaagg cgatcacgag gttctcttcc tgccggccta tatgggccgc       540
     gtgcacggcc agggagcgaa aaaaacgctt actctgaagc tgccgccggg cggaacggta       600
     cgcccctcgc aacaggatcg ggcggcgggc tatgacatta cgcggagcgc accgaatgag       660
     atcttggtat ctattccagt aggtaaagcg gatcgaaagc tgccggacat cgagatcgaa       720
     tatcccgcag ggacctttgt gaccgtaacg agcggcgagc gggtgcagtg gtggctttcc       780
     gatcactttc tcccattcat aagcattttg ggaccgctca tcgccggtct gtttgtcctc       840
     atgagattgg ggcagggctg gcgattgcct gcaccttcaa ttgctggcga tagcaaaaag       900
     acggagagca tctcgcctgc tttagccgcc tatgtgtttt ggaactggaa gccggatact       960
     gcaaaggcgg ccttcatggc gtctgtctgc catctcgcaa cgaagagact gcttcgcatt      1020
     tctggccttg gggagaatgc tgaagcttcg gatttgtctg ccaggcaggt gcgcaagaag      1080
     ggcaaggtgg cgcgcgccag atggtatggt cttccagctg tgacacgttc ggtatttggt      1140
     cgaattgaag gagagcggcc cgtcaatgat cggcgcaccg tcgtatatgc cctgtatggt      1200
     ttcgaacgtg acttgcacca gatagtcgcc gaggaatatt ggaaagttag aggcggcgca      1260
     gatcgagcag cgttgacgac ttcggctaca attctagttc ttggcattgc cactgcctat      1320
     ttgtcgggcc tcttgatttt ttccgcggcc atctgcggga tattgctcat tgtttttctg      1380
     gtggtaacaa tgttccgcca tccagagcgg tttcccgtgg ccaccggcac ctccgagcag      1440
     ttcaaacagg cgattagttt gtttgtgggt cttccggcga tactgattgt tgcactttgc      1500
     tatatcggca cgaccgaggt gatcggcgaa cagcagccat atctggtggc gatcttgctg      1560
     cacattgccg gcattatcgc cgttttggcg atgctgcgca tgccaacgtc gaagcagcgg      1620
     cagatccgca atcacatcct cagtttgcat cgttatttcc acggtgagat cgatggcccg      1680
     ccaatgtcga tcgaatgcta cgagcaccat ctgcccttcg ccgtcgcgct tggtgtcgag      1740
     caacgctgga ccgaacgttt caacctctgg cgagagagcg agaagatgga tgcctatgct      1800
     ccggattggc gaataagttc ttag                                             1824
//

If you have problems or comments...

PBIL Back to PBIL home page