(data stored in ACNUC7421 zone)

EMBL: CP001622.PE567

CP001622.PE567       Location/Qualifiers
FT   CDS_pept        597906..598457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0575"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG:
FT                   rec:RHECIAT_CH0000974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54879"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2Q9"
FT                   /inference="protein motif:PFAM:PF04011"
FT                   /protein_id="ACS54879.1"
FT                   /translation="MYVILAIIVVIALYLVFIYNGLVRARQMAEEAWSGIDVQLKRRAD
FT                   LIPNLIETVKGYAAHEKSTLEEVVELRNKAQAVPSGDVAGRAQAEGLLGQALGRVIALA
FT                   EAYPDLKANQNFAELQASLETMEGELQMARRYYNGAARDLNVKVESFPSNLVAGQFGFA
FT                   KREYFEITNEADRAVPTVKF"
     atgtatgtga tactcgctat tatcgttgtc atcgctctct atctcgtctt catttacaac        60
     ggcctggttc gcgcgcgaca gatggcggaa gaagcctggt cgggcatcga cgtccagctc       120
     aagcgccgcg ccgacctgat cccgaacctt atcgagacgg tcaagggtta tgccgcccac       180
     gaaaaatcga cgctcgaaga ggtggttgag ctccgcaaca aggcgcaggc cgtaccatca       240
     ggcgatgtcg ccggcagggc gcaggcggaa ggtctgctcg gccaggcgct cggtcgcgtc       300
     atcgcgctcg ccgaagccta tccggatctc aaggccaacc agaattttgc cgagctgcag       360
     gcctcgctgg aaaccatgga aggcgagctg cagatggccc ggcgttatta caatggtgct       420
     gcccgcgacc tgaacgtcaa ggttgaaagc ttcccgtcca atctcgttgc cggtcagttc       480
     ggttttgcca agcgggaata tttcgagatc acgaatgagg ccgatcgtgc cgttcccacc       540
     gtgaaattct ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page