(data stored in ACNUC7421 zone)

EMBL: CP001622.PE568

CP001622.PE568       Location/Qualifiers
FT   CDS_pept        598618..599880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0576"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="KEGG: rec:RHECIAT_CH0000975 3-phosphoshikimate
FT                   1-carboxyvinyltransferase protein; TIGRFAM:
FT                   3-phosphoshikimate 1-carboxyvinyltransferase; PFAM: EPSP
FT                   synthase (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54880"
FT                   /db_xref="GOA:C6B2R0"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2R0"
FT                   /inference="protein motif:TFAM:TIGR01356"
FT                   /protein_id="ACS54880.1"
FT                   /translation="MTRTAKLTIIPPGRPLSGRAMPPGSKSITNRALLLAGLAKGTSRL
FT                   TGALKSDDTRYMAEALRAMGVTIDEPDDTTFVVTGSGRLLPPKAPLFLGNAGTATRFLT
FT                   AAAALVDGTVIVDGDEHMRKRPIGPLVEAMRTLGIDVSAETGCPPVTVKGTGRFQADRI
FT                   RIDGGLSSQYVSALLMMAAGGDRPIDIELVGEDIGALGYIDLTTAAMKAFGAKVEKTSP
FT                   VTWRVEPTGYHAADFIVEPDASAATYLWAAEVLTGGAIDLGVPSDAFSQPDARAYDMIA
FT                   KFPHLPSEIDGSQMQDAVPTLAVLAAFNETPVRFVGIANLRVKECDRIQALSTGLNRIV
FT                   SGLAREEGDDLIVQSDPALVGQHLPAEIDSFADHRIAMSFALAGLKIDGITILDPDCVG
FT                   KTFPAYWRTLAALGVTYQDKD"
     atgacacgca cagccaaact cacgatcatt ccgccgggca ggccgctttc gggccgcgcc        60
     atgccgcccg gctccaagtc gatcaccaat cgcgcgctgc tgcttgccgg ccttgcgaag       120
     ggcacgagcc ggctgaccgg ggcgctgaag agcgacgata cgcgttatat ggccgaagcg       180
     ctgcgtgcca tgggtgttac gatcgacgag cctgacgata ccaccttcgt cgtcaccggc       240
     agcggcaggc tactgccgcc gaaggcgccg ctcttcctcg gcaatgccgg cacggcgaca       300
     cgtttcctga cggcggctgc ggctttggtc gacggcacgg tcatcgtcga tggcgacgaa       360
     catatgcgca agcgcccgat cgggccgctg gtcgaggcga tgcgaacgct cggcatcgac       420
     gtgagtgccg agaccggctg cccgccggtc accgtcaagg gcaccggccg cttccaggcc       480
     gaccgcatcc gcatcgatgg cggcctgtcc agccagtatg tttcggcgct gctgatgatg       540
     gcggccggcg gcgaccggcc gatcgacatc gaactcgtcg gcgaggacat cggcgcgctc       600
     ggctatatcg atctgaccac ggcggcgatg aaggctttcg gcgccaaggt cgagaagacc       660
     agcccggtca catggcgcgt cgagccgacc ggctaccacg ctgccgactt catcgtcgag       720
     ccggatgcct cggccgcgac ctatctctgg gccgccgaag tcctcacagg cggcgcgatc       780
     gatctcggtg ttccctccga cgccttttcg cagccggatg cgcgcgccta tgacatgatc       840
     gccaaattcc cgcatctgcc gtcggagatc gacggctcgc agatgcagga tgccgttccc       900
     acccttgccg tgcttgccgc cttcaacgag acgccggttc gcttcgtcgg catcgccaac       960
     ctgcgcgtca aggaatgcga ccgcatccag gcgctctcga ccggcctcaa ccgcattgtt      1020
     tcaggccttg cccgcgagga gggtgacgat ctgatcgtgc agtcggatcc cgcacttgtg      1080
     ggccaacatc tgccggcgga gatcgacagc ttcgccgacc accgcatagc tatgagtttc      1140
     gcgctggccg gcctgaagat cgacggcatc accattctcg atcccgattg cgtcggcaag      1200
     accttccccg cctattggcg gacgctggcc gccctcggcg tgacctatca ggacaaagat      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page