(data stored in ACNUC7421 zone)

EMBL: CP001622.PE569

CP001622.PE569       Location/Qualifiers
FT   CDS_pept        599919..601853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00885 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54881"
FT                   /db_xref="GOA:C6B2R1"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2R1"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00885"
FT                   /protein_id="ACS54881.1"
FT                   /translation="MGRRFFGFCFALLLMLAAPAAFAAEVIDSFASDITLEKSGAMTVT
FT                   ETITVNAEGNQINHGIFRDFPLYFTDAAGRRRSVDFDMVSVQRDGDNEPWHTESISGGI
FT                   RIYAGSADVTVTPGRHRYVFTYRTNRQIRYFDDHDELYWNVTGNGWIFPIRSATATVKL
FT                   PPDVGATETTFFTGPEGATGKNARVSESGAGLVFSTTAPLDAYEGLTFAIRMPKGSIDP
FT                   PSADMESTWWLKDNRNYFIGFGGLLLVLAYYTRSWLKVGRDPARGVVVPRWDAPDGISP
FT                   ALVNYIDNKGFSGEGWTALSATALNLAVRGYVKLEDLKNSIVIQGTGKPLGKEKFQAGE
FT                   IELLKVAGGAGSTLTIDKANGERVKSVGQAFRSAIEKEHRGKYYNSNLGYTAGGIVLSA
FT                   AALVILFVFGSLAPDTIALMLIPIAISVFVAVFAAGLVRSLHRGKSLFGKIIAIISAAI
FT                   GVFVGISILATMVLALASSLVELHETPMLFAVGGIVLLNILYVFIMGAPTPLGAKMMDG
FT                   IDGLRQYLTLAEKDRMNTAGAPEMSPRHFETLLPYAVALGVEKPWSRTFETWLAAAAAG
FT                   AAAAYAPAWYAGNFNSGSFSDRIGGFSSSMASTIASTIPAPPPSSSSSGFSGGGSSGGG
FT                   GGGGGGGGW"
     atggggcgtc ggtttttcgg attttgcttt gcactgctgt tgatgctcgc cgccccggcg        60
     gcctttgccg ccgaggtgat cgacagtttt gcctccgaca ttacgctcga aaaaagcggt       120
     gcgatgacgg tgacggaaac gatcaccgtc aatgccgaag gcaatcagat caaccacggc       180
     atcttccgtg atttcccgct ctatttcacc gatgccgcgg gtcgccgccg cagcgtcgat       240
     ttcgatatgg tgtcggtcca gcgcgacggc gataacgagc cctggcacac tgaatcgata       300
     tcaggcggca tccgcatcta tgccggttct gccgacgtga ccgtgacgcc gggccgtcat       360
     cgatacgtct tcacctacag gaccaatcgc cagatccgct atttcgacga tcatgacgaa       420
     ctctattgga acgtcaccgg caacggctgg atcttcccga tccgctcggc cacggcgacg       480
     gtgaagctgc cgcctgatgt cggcgcgacg gagacgacct tcttcaccgg ccctgaggga       540
     gccaccggaa agaatgcccg cgtcagcgag agcggcgctg gcttggtctt ttccaccacc       600
     gcgccgcttg atgcctacga aggcctgacc tttgcgattc gcatgccgaa ggggtctatc       660
     gatccgccga gcgcggatat ggaaagcacc tggtggctga aggacaaccg caattatttc       720
     atcggcttcg gcggtctgct cctggttttg gcatattaca cgcgctcctg gctgaaggtc       780
     ggccgcgatc ctgcccgtgg cgtcgtcgtg ccgcgctggg acgcgcctga tggtatctcg       840
     ccggcgctgg tcaactatat cgacaataag ggcttctccg gcgagggctg gacggcgctg       900
     tccgccaccg cgctcaatct tgccgtccgc ggttacgtca agctcgaaga cctgaagaat       960
     tcgattgtca ttcaaggcac cggcaagcca ctcggcaagg agaaattcca ggccggcgaa      1020
     atcgaattgc tgaaggtcgc cggcggcgcc ggttcgacgc tgacgatcga caaggccaat      1080
     ggcgagcggg tgaagtccgt cggccaggcc tttcgctcgg cgatcgagaa agaacatcgc      1140
     ggcaaatatt acaattccaa cctcggctat accgccggcg gcatcgtgct cagcgccgca      1200
     gccctagtga tcctgttcgt cttcggttcg ctggcgccgg ataccatcgc gctgatgctg      1260
     atcccgatcg ccatttcggt cttcgttgcg gtgttcgccg ccggcctcgt caggtcgctg      1320
     catcgcggca agtcgctgtt cggtaagatc atcgccatca tctccgccgc gatcggcgtc      1380
     ttcgtcggca tcagcatcct ggcgaccatg gtgctggcgc ttgcctcgtc gctggtggaa      1440
     ctgcacgaaa cgccgatgct gtttgccgtc ggcggcatcg tgctgctcaa catcctctat      1500
     gtcttcatca tgggtgcacc gaccccgctc ggcgccaaga tgatggatgg catagacggc      1560
     ctgcgccaat atctgacgct tgccgagaag gaccggatga acacggccgg cgccccggaa      1620
     atgtcgccac ggcatttcga gacgctgctg ccctatgcgg tggcgctcgg cgtcgaaaaa      1680
     ccctggtcac gcaccttcga gacctggctt gctgcagccg ctgccggtgc ggctgcagcc      1740
     tatgcgcccg cctggtatgc cggcaatttc aacagcggca gcttttccga tcgtatcggt      1800
     ggtttttcct cgtccatggc ctcgaccatc gcgtcgacga tacccgcgcc gccgccctca      1860
     agttcatcct ccggtttttc cggcggcggc tcgtccggcg gcggtggcgg aggtggggga      1920
     ggcgggggct ggtaa                                                       1935
//

If you have problems or comments...

PBIL Back to PBIL home page