(data stored in ACNUC7421 zone)

EMBL: CP001622.PE57

CP001622.PE57        Location/Qualifiers
FT   CDS_pept        complement(57996..58328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54369"
FT                   /db_xref="GOA:C6AYE5"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE5"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00398"
FT                   /protein_id="ACS54369.1"
FT                   /translation="MAKKIVNLLILLPLGVILIVFCVANRQSVTLAFNPFRPDDQVLAV
FT                   SAPFFVFLVVVLIAGMLIGAAATWFSQGKHRRRARTEAKEAIRWQSEADRHKNRAEEIA
FT                   GQLPAR"
     atggccaaga agatcgtcaa cctgttgatt ctgctgccgc tcggcgtcat cctcatcgtc        60
     ttctgcgtcg ccaaccggca gagcgtcacg ctcgccttca atccgttccg gcctgatgat       120
     caggtgctgg cggtttctgc gcccttcttc gtcttcctgg tcgtcgtgct gatcgccggc       180
     atgctgatcg gggcggccgc gacctggttc agccagggca aacaccgcag gcgcgcccgc       240
     accgaggcca aggaagccat ccgctggcaa agcgaggccg accgccacaa gaaccgcgcc       300
     gaggaaatcg ccgggcagct gccggcgcgg taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page