(data stored in ACNUC7421 zone)

EMBL: CP001622.PE570

CP001622.PE570       Location/Qualifiers
FT   CDS_pept        601919..603196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0578"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: rec:RHECIAT_CH0000977
FT                   phosphoribosylamine-glycine ligase protein; TIGRFAM:
FT                   phosphoribosylamine/glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54882"
FT                   /db_xref="GOA:C6B3G1"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G1"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ACS54882.1"
FT                   /translation="MKVLLIGSGGREHALAWKLAQSPLMSEFYAAPGNPGIAEHAVLVP
FT                   VDIEDHEAVVAFCKDKAIDFVVVGPEAPLVAGLADRLRADGLAVFGPSAAAAQLEGSKG
FT                   FTKDICARYGIPTGAYQRFNNGPKAKAYIRAEGVPIVVKADGLAAGKGVTVAMTLDEAL
FT                   AAVDDCFEGAFGAAGAEVVVEAYLDGEEASFFCLCDGKHALPLATAQDHKRVGEGDTGV
FT                   NTGGMGAYSPAPVMTAEMVERTMKEIIEPTMRGMAESGHPFSGVFFAGLMITKKGPELI
FT                   EYNVRFGDPECQVMMMRLKSDLLPLLLATANGTLDQVKAEWNEDPALTVVMASKGYPGA
FT                   YDKNTPILSLPDAGKGEKVFHAGTGLKDGALVATGGRVLNVTASGGTVAEAKSRAYALL
FT                   DRVRWENGFCRRDIGWRAIEREMGSE"
     atgaaggttc tgttgatcgg atcgggcgga cgcgagcacg cgctcgcctg gaagctggcg        60
     caatcgccgc tgatgagcga attctacgcc gcacccggca atcccggcat tgccgaacac       120
     gccgtgctcg tgccggttga catcgaggat cacgaagcgg tcgtggcctt ctgcaaggac       180
     aaggcgatcg atttcgtcgt cgtcggcccg gaagcgccgc tggttgccgg cctcgccgac       240
     cggctgcgcg ccgatggcct ggcggtcttc ggtccctccg ctgccgcagc ccagctcgag       300
     ggttccaaag gtttcaccaa ggatatctgc gcccgctacg gcattccgac aggcgcctac       360
     cagcgcttca acaatggacc gaaggccaaa gcctatatcc gcgccgaggg cgtgccgatc       420
     gtcgtcaagg ccgatggtct tgccgccggc aagggcgtga cggttgcgat gacgctcgat       480
     gaagctttgg ccgcggtcga cgactgcttc gagggcgcct ttggtgctgc cggcgccgaa       540
     gtcgtcgtcg aagcttatct cgatggcgag gaagcgagct tcttctgcct ctgcgatggc       600
     aaacatgcgc tgccgcttgc aaccgcccag gatcacaagc gggtgggcga gggcgatacc       660
     ggcgtcaata ccggcggcat gggcgcctat tcgccggcgc ctgtgatgac cgccgaaatg       720
     gtcgagcgca ctatgaaaga gatcatcgaa ccgacgatgc gcggcatggc cgagagtggt       780
     catcctttct ccggtgtctt tttcgccggg ctgatgatca ccaagaaggg gccggagctg       840
     atcgaataca atgtccgctt cggcgatccc gaatgccagg tgatgatgat gcggttgaag       900
     agcgatctcc tgccgctgct gctcgccacc gccaacggca cgctcgatca ggtcaaggcc       960
     gaatggaacg aggatccggc actgacggtg gtcatggcct cgaagggtta tccgggcgcc      1020
     tacgacaaga acacgccgat cctttccctg ccggacgcag gcaagggcga gaaggtgttt      1080
     catgccggca cgggtctgaa ggacggcgcg ctggttgcga ccggcggccg tgtgctgaat      1140
     gtcaccgcgt caggcggcac ggtcgccgag gcgaagagcc gcgcctacgc gctgctcgac      1200
     agggtgagat gggaaaacgg cttctgccgg cgcgacatcg gctggcgcgc gatcgagcgc      1260
     gaaatgggct cggaatga                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page