(data stored in ACNUC7421 zone)

EMBL: CP001622.PE571

CP001622.PE571       Location/Qualifiers
FT   CDS_pept        603296..603757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54883"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G2"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000978"
FT                   /protein_id="ACS54883.1"
FT                   /translation="MRQIFLGAAILLMAGPVMASSIEVVGKTAPRAESSIVTESCAHCP
FT                   PLQAELTKKDYTVPELKPGVLQASEVRDVGGEKKIYRTEGWMGGSPVVFVSKATPESMI
FT                   AAAPPAAPVDGIDMNATTAAVIGDDARPVEAGMTEQPAALNASEFKLRF"
     atgcgtcaga ttttcctcgg tgcggcaatc ctgctgatgg caggccctgt gatggcgtcc        60
     tcgatagagg tggtcggcaa gaccgcgccg cgcgctgaaa gcagcatcgt caccgaaagc       120
     tgcgcccatt gcccgccgct ccaggccgag ctcaccaaga aggactatac ggtgccggag       180
     ctgaaacccg gcgtcctcca ggcgagtgaa gtccgcgatg tcggcggcga aaagaagatc       240
     tatcgcaccg aaggctggat gggcggctcg ccggtcgtct tcgtcagcaa ggcgacgcct       300
     gaatccatga ttgcggccgc gccgccggcg gcgccggtag acggcatcga catgaatgcg       360
     acgacggcgg ccgtcattgg cgacgacgcc aggcctgttg aagcaggcat gacggaacaa       420
     ccggcagctc ttaacgcttc cgaattcaag ctgcgtttct ag                          462
//

If you have problems or comments...

PBIL Back to PBIL home page