(data stored in ACNUC7421 zone)

EMBL: CP001622.PE572

CP001622.PE572       Location/Qualifiers
FT   CDS_pept        604186..606006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0580"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache type 2
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; KEGG: ret:RHE_CH00888
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54884"
FT                   /db_xref="GOA:C6B3G3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G3"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54884.1"
FT                   /translation="MKKLKIAHQLFALIGVLMAAFAVATYFEIRTSEQAIYDERFDMLR
FT                   TQVESGISVLNTFYEREKAGQMTHEAAQTEAFEILKRVSFQPSGYLFGFDYNVVQLFHP
FT                   SPVNLGKDMSGQVDKTGAKFSQALVDNGKAGGGRTFYYWTKPGQPEDQVFLKGGYSKAF
FT                   EPWKIVVGTGVYLDDLQQKVNATIWKALTASLIVFVCGIAAAVFFIRGISHPLKDIHNA
FT                   LQSVAEEDVSISIPHTGMNNEVGMMAKATQSLQEKIRERHAMSDREAAQQLALESEREN
FT                   NLRQQQDETTLQARVVATIGQALEMIARGDLTVRCADLGQKYAALRDNFNDALSHLEAA
FT                   MAKVSAKGTDIGTSKEEIRRASNELSQRTERQAASLEETSAALDELTVAVRQTADGAHE
FT                   ASKRVHSVSTEATHSDAIVTQAIEAMSGIEKSSSEITKIIGVIDEIAFQTNLLALNAGV
FT                   EAARAGESGKGFAVVAQEVRELAQRSAAAAKEIKDQIARSSSQVDHGVRLVGEAGEALK
FT                   RISDQIKAANEIVAKIAHSASEQDTTLRSISSSMNQLDAATQQNAAMAEETTASAETLA
FT                   TDTDELIDLIRGFRVSAPQHRQAEPMRRAS"
     atgaaaaagc tcaagattgc gcatcaactt tttgcgctga tcggcgtcct aatggctgct        60
     tttgcagtcg ccacctattt cgaaatccgc acctccgaac aggcaattta cgacgagcgt       120
     ttcgacatgc tgcgcacaca ggtcgaatcg ggcatctccg ttctcaatac cttctatgag       180
     cgcgagaagg ccggccagat gacgcatgag gccgcccaga cggaagcctt cgagatcctg       240
     aagcgcgtca gcttccagcc atccggttac ctcttcggtt tcgactacaa cgtcgttcag       300
     ctttttcatc cgagcccggt caatctcggc aaggacatga gcggccaggt cgacaagacc       360
     ggcgcgaaat tcagccaggc gctggtcgac aacggcaagg ccggcggcgg ccgcaccttc       420
     tactattgga ccaaaccggg ccagccggaa gaccaggtct tcctcaaggg cggttattcc       480
     aaggccttcg agccctggaa gatcgtcgtc ggcaccggcg tctatctcga tgacttgcag       540
     cagaaggtca atgcgacgat ctggaaggcg ctgaccgctt cgctgatcgt cttcgtctgc       600
     ggcatcgccg ccgccgtctt cttcatccgt ggcatctccc atccgctgaa ggacatccac       660
     aatgccctgc agtcggtcgc cgaagaggat gtttcgatca gcatcccgca taccggcatg       720
     aacaacgaag tcggcatgat ggcgaaggcg acgcagtcac tgcaggaaaa gatcagggag       780
     cgtcatgcga tgtccgatcg cgaggcggcc cagcaactgg cgctggaaag cgagcgcgaa       840
     aacaatctgc gccagcagca ggatgagacg acgctgcagg cgagggtggt ggcgacgatc       900
     ggccaggcgc tggagatgat tgcccgtggt gatctcaccg tccgctgcgc cgatctcggc       960
     cagaagtatg ccgcccttcg cgacaacttc aacgatgcgc tgtcgcatct cgaggccgcc      1020
     atggccaagg tcagcgccaa gggcaccgat atcggcacca gcaaggaaga gatccgccgc      1080
     gcctccaacg aactgtcgca gcgcaccgag cgccaggccg ccagcctgga agaaacctcg      1140
     gccgctctcg acgaactcac cgtcgccgtc cgtcagacgg ctgacggcgc ccatgaggcg      1200
     agcaagcgtg tccattcggt cagcaccgaa gcgacccata gcgatgcgat cgtcacccag      1260
     gcgatcgagg cgatgagcgg catcgagaaa tcgtcgtcgg agatcaccaa gatcatcggc      1320
     gtcatcgacg agatcgcctt ccagaccaac ctgcttgctc tcaacgcagg cgtcgaggca      1380
     gcccgtgccg gtgaatccgg caagggtttt gcggttgtcg cccaggaagt gcgtgaactt      1440
     gcccagcgct ctgccgctgc ggccaaggag atcaaggacc agatcgcccg ctcctccagc      1500
     caggtggatc atggcgtccg tctggtcggc gaggcaggcg aggcgctgaa gcggatctcc      1560
     gaccagatca aggctgccaa cgagatcgtc gccaagatcg cccacagcgc ttccgaacag      1620
     gatacgacgc tgcgctcgat ctcctcgtcg atgaaccagc tcgacgccgc cacccagcag      1680
     aatgccgcca tggccgaaga gaccacggca tcggccgaga cgctggccac cgataccgac      1740
     gagctgatcg acctcatccg cggcttccgc gtcagtgcac cacagcaccg ccaggccgaa      1800
     ccgatgcgcc gagccagctg a                                                1821
//

If you have problems or comments...

PBIL Back to PBIL home page