(data stored in ACNUC7421 zone)

EMBL: CP001622.PE573

CP001622.PE573       Location/Qualifiers
FT   CDS_pept        606268..608091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0581"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache type 2
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; KEGG: ret:RHE_CH00888
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54885"
FT                   /db_xref="GOA:C6B3G4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G4"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54885.1"
FT                   /translation="MKNLKISKQLILLVVGLMVAFAIATSLQIRSSVNAIYNERYDMLR
FT                   AEVQSAVSVLKIYQAKVTAGEMTLEDAQKQAYATVNAMKYDPDGYFFGYSYDIQMMFHY
FT                   DAAKIGQVNKGQPDSKGKLYREELVKLGQQGGGLVEYYSTAKPGQPAGDFRKTAYAQAF
FT                   DPWKVVVVTGVYMDDLDAQINSTILTALSGSIVLFFLAMAAAYVVIRGISGPLNNVHAA
FT                   LKAVAEEDVSIAIPHTGMNNEVGMMAKATQSLQEKIRERHAMSDREAAQQLALESEREN
FT                   NLRQQQDEATLQARVVTTIGQALEMIARGDLTVRCADLGQKYAALRDNFNDALSHLEAA
FT                   MAKVSAKGTDIGTSKEEIRRASNELSQRTERQAASLEETSAALDELTVAVRQTADGAHE
FT                   ASKRVHSVSTEATHSDAIVTQAIEAMSGIEKSSSEITKIIGVIDEIAFQTNLLALNAGV
FT                   EAARAGESGKGFAVVAQEVRELAQRSAAAAKEIKDQIARSSSQVDHGVRLVGEAGEALK
FT                   RISDQIKAANEIVAKIAHSASEQDTTLRSISSSMNQLDAATQQNAAMAEETTASAETLA
FT                   TDTDELIDLIRGFRVSGESAAPAMHQGRRAA"
     atgaaaaatt tgaagatatc gaagcagctc atattgctgg tcgtcggcct gatggtggcg        60
     tttgcaatcg ccacctccct gcagatccgc tcctcggtca atgcgatcta caacgaacgc       120
     tatgacatgc tgcgggcgga ggtacagtct gcggtctctg ttctcaaaat ctaccaggca       180
     aaggtgactg ccggcgaaat gacgctggaa gatgcccaga agcaggccta cgccacggtc       240
     aatgcaatga aatacgaccc cgatggttat ttcttcggct atagctacga catccagatg       300
     atgttccact acgatgccgc gaaaatcggt caggtcaaca agggtcagcc ggacagcaaa       360
     ggaaagctct atcgagaaga gctggtcaag ctcgggcagc agggcggcgg tctcgtcgaa       420
     tattattcca cagccaaacc aggccagccc gccggcgatt ttcgcaagac ggcctatgca       480
     caggccttcg atccttggaa ggtcgtcgtc gtcaccggcg tctacatgga cgatctcgat       540
     gctcagataa acagcacgat cctgaccgcg ctctccggca gcatcgtcct gttcttcctt       600
     gccatggccg ccgcctacgt cgtcatccgc ggcatatcgg gacctctcaa caacgtccat       660
     gccgccctga aggctgtcgc cgaagaggat gtctccattg ccatcccgca taccggcatg       720
     aacaacgaag tcggcatgat ggcgaaggcg acgcagtcac tgcaggaaaa gatcagggag       780
     cgtcatgcga tgtccgatcg cgaggcggcc cagcaactgg cgctggaaag cgagcgcgaa       840
     aacaatctgc gccagcagca ggatgaagca acgctccagg cacgcgtggt gacgacgatc       900
     ggccaggcgc tggagatgat tgcccgcggt gatcttaccg tccgctgcgc cgatctaggc       960
     cagaaatacg ccgcccttcg cgacaacttc aacgatgcgc tgtcgcatct cgaggccgcc      1020
     atggccaagg tcagcgccaa gggcaccgat atcggcacca gcaaggaaga gatccgccgc      1080
     gcctccaacg aactgtcgca gcgcaccgag cgccaggccg ccagcctgga agaaacctcg      1140
     gccgctctcg atgagctcac cgtcgccgtc cgtcagacgg ccgatggcgc ccatgaggcg      1200
     agcaagcgcg tccattcggt cagcaccgaa gccactcata gcgatgcgat cgtcacccag      1260
     gcgatcgagg cgatgagcgg catcgagaag tcgtcctcgg agatcaccaa gatcatcggc      1320
     gtcatcgacg agatcgcctt ccagaccaac ctcttggcgc tgaacgccgg cgtcgaggca      1380
     gcccgtgccg gtgaatccgg caagggtttt gcggttgtcg cccaggaagt ccgtgaactt      1440
     gcccagcgct ccgccgctgc ggccaaggag atcaaggacc agatcgcccg ctcctccagc      1500
     caggtcgacc atggcgtccg tctggtcggc gaggcaggcg aggcgctgaa gcggatctcc      1560
     gaccagatca aggctgccaa cgagatcgtc gccaagatcg cccacagcgc ttccgaacag      1620
     gatacgacgc tgcgttcgat ctcctcgtcg atgaaccagc tcgacgccgc cacccagcag      1680
     aatgccgcca tggccgaaga gaccacggca tcggccgaga cgctggccac cgataccgac      1740
     gagctgatcg acctcatccg cggcttccgc gtcagtggcg aaagcgctgc cccggccatg      1800
     catcagggtc gccgcgccgc ataa                                             1824
//

If you have problems or comments...

PBIL Back to PBIL home page