(data stored in ACNUC7421 zone)

EMBL: CP001622.PE574

CP001622.PE574       Location/Qualifiers
FT   CDS_pept        complement(608170..608658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0582"
FT                   /product="protein of unknown function DUF523"
FT                   /note="PFAM: protein of unknown function DUF523; KEGG:
FT                   rec:RHECIAT_CH0000979 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54886"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G5"
FT                   /inference="protein motif:PFAM:PF04463"
FT                   /protein_id="ACS54886.1"
FT                   /translation="MQSKILVSACLMGQAVRYDGRAKPLLHPVIETWRAEGRLVTICPE
FT                   MSAGMTVPRPPAEIAEAATGEDVLAGTARVVELTGADVTEEFLLAAENAVALARQAGCH
FT                   YALLIDGSPSCGSGFIYDGTFSGRKEAGNGVTAAALKAAGVEVFSDREIERLIERIGQ"
     atgcagagca agattctcgt cagcgcctgt ctcatgggcc aagccgtccg ctatgacggg        60
     cgggcgaagc cgttgcttca tccggttatc gagacatggc gggccgaggg ccggttggtg       120
     acgatctgtc cggagatgtc ggcgggcatg acggtgccgc ggccgccggc ggagatcgca       180
     gaagcggcga ccggcgagga tgtgctggcc ggcacggcgc gggttgtcga gctgacgggc       240
     gccgacgtaa cggaagagtt cctgctggcg gcggaaaatg ccgtggcgct cgcgcggcaa       300
     gccggctgcc actatgcgct gctcatcgac ggcagcccgt cctgcggctc cggtttcatc       360
     tatgacggca cgttttccgg ccgcaaggag gccggcaacg gcgtgacggc ggctgcgctg       420
     aaagcagccg gcgttgaagt gttttccgat cgcgagatcg agcggctgat cgaacgcatc       480
     gggcaatga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page