(data stored in ACNUC7421 zone)

EMBL: CP001622.PE575

CP001622.PE575       Location/Qualifiers
FT   CDS_pept        complement(608717..610831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0583"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: rec:RHECIAT_CH0000980 glycyl-tRNA synthetase
FT                   protein, beta subunit; TIGRFAM: glycyl-tRNA synthetase,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54887"
FT                   /db_xref="GOA:C6B3G6"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G6"
FT                   /inference="protein motif:TFAM:TIGR00211"
FT                   /protein_id="ACS54887.1"
FT                   /translation="MPNLLLELRSEEIPARMQRKAAGDLKKLVTDALVEAGLSYEGARE
FT                   YWTPRRLALDIHGLTARSADVREERKGPRTDANEKAIEGFLRGAGLSSVSEAQVVSDPK
FT                   KGDFYVAVISKPGRATEEIVSDVMPGIIRDFPWPKSMRWGKASSKPGALRWVRPLQSIV
FT                   CTFGPEHEETTVIPFEIDGITASNITYGHRFHAPEAITVRRFDDYAANLEKAKVILDAE
FT                   RRKDIILHDARDIAFANGLELVEDEGLLEEVSGLVEWPQVLMGSFEEDYLSIPSEIIRL
FT                   TIKTNQKCFVTRPQGGETLSNKFILVSNIQASDGGKEIVHGNGKVVRARLSDALHFWKR
FT                   DQGNLPDLETLEASAAKFGLDLKKPLDQRMAKLDALDVTFHAKLGTQGARVARIRTLAK
FT                   ELADITGADAALIDRAAVLAKADLRTEAVGEFPELQGLMGRKYAVLQGEDASVAAAIED
FT                   HYKPQGPSDRVPEDRVAITIALADKLDTLIGFWAIDEKPTGSKDPFALRRAALGVVRIL
FT                   LERRIRLPLLATTKDGDLLSFFHDRLKVYLRDQGARHDLIDAVLTSDADDLLMVARRVE
FT                   ALTAFITSEDGKNLLSGTKRATQLLAAEEKKGTVIADGVSPALLTLDAEKELFAAISGA
FT                   SKDASDAVAGEDFRSAMEALSKLRGPVDRFFEDVLVNDEDAAIRANRLALLRLIREATG
FT                   TVADFSKISG"
     atgccaaacc ttcttctcga actccgctcc gaagagattc cggcccgcat gcagcgcaag        60
     gctgccggcg acctgaagaa gctcgtcacc gatgcgcttg tcgaagcggg tctgtcctac       120
     gagggcgcgc gcgaatattg gacgccccgg cggctcgccc tcgacattca cggactgacg       180
     gcgcgctcgg ccgatgtgcg cgaggagcgc aagggaccgc gcaccgacgc caacgagaag       240
     gcgatcgaag gcttcctgcg cggcgccggc ctttcctccg tctccgaagc gcaggtggtc       300
     agcgatccga agaagggcga tttctacgtc gcggtcatct ccaagcccgg ccgcgcaacg       360
     gaagagatcg tcagcgatgt catgcccggc atcatccgcg attttccctg gccgaaatcg       420
     atgcgctggg gcaaggcctc gtcgaagccc ggcgcgctgc gctgggtgcg gccgctgcag       480
     tcgatcgtct gcaccttcgg cccggagcat gaagagacca ccgtgatccc cttcgagatc       540
     gacggcatca ccgcctccaa catcacctac ggccatcgtt tccacgcgcc cgaggcgatc       600
     accgtccggc gcttcgacga ttatgcggcg aacctggaaa aggccaaggt catcctcgat       660
     gccgagcggc gcaaggacat catcctgcac gacgcccgcg atatcgcctt tgccaacggg       720
     ctggagctgg tggaagacga aggcctgctg gaggaagtct ccggcctcgt cgaatggccg       780
     caggtgctga tgggcagctt cgaggaggat tacctctcga tcccctccga gatcatccgg       840
     ctgacgatca agaccaacca gaagtgtttc gtgacgcggc cgcagggtgg cgaaacactg       900
     tcgaacaagt tcatcctcgt ctccaatatc caggcaagcg acggcggcaa ggaaatcgtc       960
     cacggcaacg gcaaggtggt gcgggcccgg ctttcggatg cgctgcattt ctggaagcgc      1020
     gaccagggca acttgcccga tctcgagacg ctggaagctt cggcagcaaa gttcggcctc      1080
     gacctgaaga agccgctcga ccagcgcatg gccaagctcg atgcgcttga tgtgaccttc      1140
     catgccaagc tcggcacaca gggcgcgcgt gttgcgcgca tccgcacgct ggccaaggaa      1200
     ttggctgata tcaccggcgc cgacgcggct ctcatcgatc gcgccgccgt gctcgccaag      1260
     gccgatctgc gcaccgaagc cgttggcgaa ttcccggaac tgcagggatt gatgggccgc      1320
     aaatatgcgg tgctgcaggg tgaggacgcc tccgttgccg cagcgataga ggaccactac      1380
     aagccccagg gtccgtcgga ccgcgtgccg gaggacagag tggcgatcac catcgccctt      1440
     gccgacaagc tcgatacgct gatcggtttc tgggcgatcg acgaaaagcc gacggggtcg      1500
     aaggatccgt tcgccctgcg gcgtgcggca ctcggtgtcg tcaggatcct gctggagcga      1560
     aggatccgcc tgccgctgct ggcaacgacc aaggatggcg acctgctctc cttcttccac      1620
     gaccgtctca aggtctatct gcgcgaccag ggcgcccgcc acgatctgat cgacgccgtg      1680
     ctgacttcag atgccgacga cctgttgatg gtggcgcgcc gcgtcgaagc gctgacggcc      1740
     ttcatcacct cggaagacgg caagaacctg ctttccggca ccaagcgggc gacgcagctg      1800
     cttgccgccg aggaaaagaa gggcaccgtg atcgccgatg gcgtttcgcc agcgcttctg      1860
     acgctcgatg ccgagaagga gctattcgcc gcaatctccg gcgcatcgaa ggacgcctcg      1920
     gacgccgtcg ccggggagga tttccgctcg gcgatggaag cgctttccaa actgcgcggc      1980
     ccggtcgacc gcttcttcga agacgtgctc gtcaacgacg aggacgccgc catccgcgcc      2040
     aaccgtctcg ccctgctgcg gctgatccgc gaggcgacgg gaacggttgc cgatttctcg      2100
     aagatctcgg gctaa                                                       2115
//

If you have problems or comments...

PBIL Back to PBIL home page