(data stored in ACNUC7421 zone)

EMBL: CP001622.PE576

CP001622.PE576       Location/Qualifiers
FT   CDS_pept        611051..613360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0584"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase RNase H domain protein fold; RNA binding S1
FT                   domain protein; KEGG: rec:RHECIAT_CH0000981 probable
FT                   transcriptional accessory protein (RNA binding S1 domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54888"
FT                   /db_xref="GOA:C6B3G7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:C6B3G7"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ACS54888.1"
FT                   /translation="MAADLRFLAARISAEINARPEQAKAAIELLDEGSTVPFIARYRKE
FT                   VTGGLDDTQLRNLAERLVYLRELEARRDAIVESITGQGKMTDELMTKVAGAETKAELED
FT                   LYLPYKPKRRTRAEIARERGLGPLAETILADRAREPAVLAEGFVTADVPDVKTALEGAR
FT                   DIIAEGIAENADLLGRLRAHMRQAALLKAKVVDGKQATGEKFSDYFDHSERWATAPGHR
FT                   ALAMLRGWNEEVLTLTIEADAETTSPNKPVERMIVAAYEIGTSRPGDRWLMEVASWTWR
FT                   VKLSMSLSLDLMRELRERAEEEAIHVFARNLKDLLLAAPAGSRATMGLDPGIRTGVKVA
FT                   VVDGTGKVVATSTVYPFQPRNDVRGAQVELASLIRKHNVELISIGNGTGSRETEKLVAD
FT                   MLAELPAPKPTKVIVSEAGASVYSASATAAAEFPDLDVSLRGAVSIARRLQDPLAELVK
FT                   IEPKSIGVGQYQHDVDQQKLSRSLDAVVEDAVNAVGVDLNTASAPLLSRVSGLGPSIAD
FT                   AIVRHRDSEGRFETRKDLLKVARLGGRTFEQCAGFLRIPNGKEPLDSSSVHPEAYGVAK
FT                   KIVAACGRDLRALMGDSAVLKSVDPRQFIDEKFGLPTVRDIIAELEKPGRDPRPSFKTA
FT                   TFAEGVNEISDLKPGMVLEGTVTNVAAFGAFVDIGVHQDGLVHVSQLADRFVKDPHEVV
FT                   KAGDVVKVRVVEVDAKRKRIALSMKRDDGSSAPPPRGDSRANQGSRPQNESRPAAAKPE
FT                   SQGAFGAALAEAMKRK"
     atggccgcag acctccgttt tctcgcagcc cgcatctccg ccgaaatcaa cgcccggccc        60
     gaacaggcca aagctgcaat cgagctgctc gacgaaggct ctaccgtgcc cttcatcgcc       120
     cgctaccgca aggaagtgac gggcgggctg gatgatacgc agctgcgcaa tctcgccgag       180
     cggctggtct atctgcgcga actagaagct cggcgcgacg cgatcgtcga atcgatcacc       240
     ggccagggca agatgaccga cgagctgatg accaaggtcg caggcgccga aaccaaggcc       300
     gagcttgagg atctctatct gccctacaag ccgaagcgcc gcacgcgcgc cgaaatcgcc       360
     cgtgaacgtg gcctcggccc gctcgccgag acgatcctcg ccgaccgcgc cagggaaccg       420
     gcggtattgg ccgaaggctt cgtcaccgcg gatgtgcccg atgtgaagac ggcgctcgaa       480
     ggcgcgcgcg acatcatcgc cgaaggcatt gccgaaaatg ccgacctgct cggcaggttg       540
     cgcgcccata tgcgccaggc cgcgctgctg aaggcgaaag tcgttgatgg caagcaggcg       600
     accggcgaga agttttccga ttatttcgac cattccgaac gctgggcgac cgcccccggc       660
     caccgcgcgc tcgccatgct gcgcggctgg aacgaggagg tgctgacgct gacgatcgag       720
     gccgacgccg agacgacctc tccgaacaag ccggtcgagc gcatgatcgt ggccgcctac       780
     gagatcggta ccagccgtcc cggcgaccgc tggctgatgg aggtcgcaag ctggacctgg       840
     cgcgtcaagc tttccatgtc gctctcgctc gacctgatgc gggaactgcg cgaaagggcc       900
     gaagaggagg cgatccatgt cttcgcccgc aatctcaagg atctgctttt ggctgcaccc       960
     gccggctcgc gcgcgacgat gggtcttgat cccggcatcc gcaccggcgt caaggtcgcc      1020
     gtcgtcgacg gcaccggcaa ggtggtggcg acatcgaccg tctatccctt ccagccgagg      1080
     aacgatgtgc gcggcgccca ggtcgagctc gcatcgctga tccgcaagca caatgtcgag      1140
     ctgatctcga tcggcaacgg caccggcagc cgcgaaaccg aaaagctggt ggccgacatg      1200
     ctggccgagt tgccggcgcc gaagccgacc aaggtcatcg tgtcggaagc cggcgcctcg      1260
     gtctattccg cctcggcgac cgcagcggct gaattccccg atctcgacgt atcactgcgc      1320
     ggcgccgtct ccatcgcacg ccgcctgcag gatccgctgg ccgaactcgt caagatcgag      1380
     ccgaagtcga tcggcgtcgg ccaatatcag cacgacgtcg accagcagaa gctgtcgcgt      1440
     tcgctcgatg ccgtggtgga agacgcagtg aatgccgtcg gggtcgatct caataccgcg      1500
     tctgcgccgc tgctgtcgcg cgtctccggc ctcggcccgt cgatcgccga cgccattgtc      1560
     cgccaccgcg acagcgaagg ccgtttcgag acgcgaaagg atcttctgaa ggtcgcccgc      1620
     ctcggcggcc gcactttcga gcagtgcgcc ggcttcctgc gcattccgaa cggcaaggag      1680
     ccgctcgatt cctcctcggt ccacccggag gcctatggcg tcgcaaagaa gatcgtcgct      1740
     gcctgcggcc gcgatctgcg cgcgttgatg ggcgatagcg cggtgttgaa atcggttgat      1800
     ccgcgccagt tcatcgacga gaaattcggc ctgccgacgg tcagggacat cattgcggag      1860
     ctggaaaagc ccggccgcga cccgcgtccg agcttcaaga ccgcgacctt cgccgagggc      1920
     gtcaacgaaa tttccgacct caagcccggc atggtgctcg aaggcacggt gaccaatgtc      1980
     gcggccttcg gcgccttcgt cgatatcggc gtgcaccagg atggcctggt gcatgtgtcc      2040
     cagcttgccg atcgcttcgt caaggatccc cacgaggtcg tcaaggcggg tgatgtcgtc      2100
     aaggtgcggg ttgtagaagt cgacgccaag cgcaagcgca tcgctctttc tatgaaacgc      2160
     gatgacggtt cttcagcgcc gccgccgcgg ggtgattctc gcgcgaacca gggttcccgg      2220
     ccgcagaacg agagccggcc cgcggccgcg aaacccgaga gccagggcgc tttcggcgcg      2280
     gcacttgccg aagcgatgaa gcgaaaataa                                       2310
//

If you have problems or comments...

PBIL Back to PBIL home page